KEGG   Mus musculus (mouse): 109711Help
Entry
109711            CDS       T01002                                 

Gene name
Actn1, 3110023F10Rik, Actn1a
Definition
(RefSeq) actinin, alpha 1
  KO
K05699  
actinin alpha
Organism
mmu  Mus musculus (mouse)
Pathway
Focal adhesion
Adherens junction
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Amoebiasis
Viral carcinogenesis
Systemic lupus erythematosus
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    109711 (Actn1)
  Cellular community
   04510 Focal adhesion
    109711 (Actn1)
   04520 Adherens junction
    109711 (Actn1)
   04530 Tight junction
    109711 (Actn1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    109711 (Actn1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    109711 (Actn1)
  Immune diseases
   05322 Systemic lupus erythematosus
    109711 (Actn1)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    109711 (Actn1)
  Infectious diseases
   05146 Amoebiasis
    109711 (Actn1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     109711 (Actn1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109711 (Actn1)
  Exosomal proteins of colorectal cancer cells
   109711 (Actn1)
  Exosomal proteins of bladder cancer cells
   109711 (Actn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12 C3; 12 36.49 cM
AA seq 892 aa AA seqDB search
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggaccattatgattcccagcagaccaacgactacatgcagcctgaagaggactgggat
cgggacctgctcctggatccggcctgggagaagcagcagaggaagacgttcacagcctgg
tgcaactcccacctgcgcaaagcggggacacagatcgagaacatcgaagaggacttccga
gatggcctgaagctcatgctgctcctggaggtcatctcaggtgaacgcttggccaagcca
gagagaggcaagatgagagtgcacaagatctccaacgtcaacaaggccttggatttcata
gccagcaaaggggtcaagctggtgtccatcggagctgaagaaattgtggatgggaatgtg
aagatgaccctgggcatgatctggaccatcattctccgctttgccatccaggacatctcc
gtggaagagacttcagctaaagaagggttactcctgtggtgtcagaggaagacagcccca
tataaaaatgtcaacatccaaaacttccacatcagttggaaagatggtcttggtttctgt
gccttgatccaccgacaccggcccgagttgattgactatggaaagcttcgaaaggatgat
ccactcacaaacctgaacacggcctttgatgtggcagagaggttcctggacatccctaag
atgctggatgctgaagacatcgtcggaactgcccggccagatgagaaagccattatgact
tatgtgtctagcttctatcatgccttctctggagcccagaaggcagaaacagcagccaat
cgcatctgcaaagtgttggcggtcaatcaagagaacgagcagcttatggaagactatgag
aagctggccagtgatctgttggagtggatccgccgcaccatcccatggctggagaatcgg
gtgcctgagaacaccatgcatgccatgcagcagaagctggaggacttccgagactataga
cgcctgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaactttaacacg
ctgcagaccaagctgcggctcagcaaccggcctgccttcatgccctccgagggcaggatg
gtctcggatatcaacaatgcctggggctgcctggaacaggccgagaagggctacgaggag
tggctgctgaatgagatccggaggctagagaggttggaccacctggcagagaagttccgg
cagaaggcctccatccatgaagcctggacggatggcaaagaagccatgcttcggcagaag
gattatgagacagccaccctgtccgagatcaaggccttgctcaagaagcacgaggctttt
gagagtgatctggctgcccaccaggaccgcgtggagcagattgcggccattgcccaggag
cttaatgagctggactactatgactcgccaagtgtcaacgctcgttgccaaaagatctgt
gaccagtgggacaatctaggggctctcactcagaagcggagggaagctttagagcgaaca
gagaagctgctggaaaccatcgaccagctctacttagagtacgccaagagggctgcaccc
ttcaacaattggatggagggagccatggaggacctgcaggacaccttcatcgtacatacc
atcgaggagatccagggactgaccacagcccatgagcagttcaaggccaccctcccggat
gcagacaaggagcgcctcgccattctgggcatccacaatgaagtgtccaagatcgtccag
acctatcatgtcaacatggcaggcaccaacccctatacaaccatcacgcctcaggagatc
aatggcaaatgggaccatgtacggcagctagtgccccggagggaccaggctctcacagag
gaacatgcaaggcagcagcacaatgagaggctacgcaaacagtttggcgcacaagccaat
gtcattgggccctggatccagaccaagatggaggagattgggaggatttccattgagatg
cacggcaccctggaggaccaactcagccacctgcggcagtatgagaagagcatcgtcaat
tacaagccaaagattgaccagctggagtgcgaccaccagctcatccaggaggcacttatc
tttgacaataagcacaccaactacaacatggagcatatccgtgtgggctgggagcagctg
ctcaccaccattgccaggaccatcaatgaagtggagaaccagatcttgacccgggatgcc
aaaggcatcagccaggaacagatgaacgaattccgcgcctctttcaaccactttgaccgg
gatcactccggcacgttgggtcccgaagagttcaaagcctgcctcatcagcttgggttat
gatattggcaacgacccccagggagaggcagagtttgcccgaatcatgagcattgtagac
cccaaccgcttgggggtagtgacgttccaggccttcatcgactttatgtcccgagagacg
gcagatactgatactgcagatcaggtcatggcttccttcaagatcctggctggagataag
aattacatcacagaggatgagctgcgccgtgagctgccccctgaccaagccgagtactgc
atcgcaagaatggccccctacgcgggccccgactccgtgcccggtgctttagactacatg
tccttctccacggcactgtatggcgagagcgacctctaa

DBGET integrated database retrieval system