KEGG   Mus musculus (mouse): 109978Help
Entry
109978            CDS       T01002                                 

Gene name
Art4, 4432404K01Rik, ARTC4, DO, DOK1
Definition
ADP-ribosyltransferase 4 (EC:2.4.2.31)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     109978 (Art4)
Cellular antigens [BR:mmu04090]
 Proteins
  109978 (Art4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 G1; 6 66.72 cM
AA seq 300 aa AA seqDB search
MALWLPGGQLTLLLLLWVQQTPAGSTEAPLKVDVDLTPDSFDDQYQGCSEQMVEELNQGD
YFIKEVDTHKYYSRAWQKAHLTWLNQAKALPESMTPVHAVAIVVFTLNLNVSSDLAKAMA
RAAGSPGQYSQSFHFKYLHYYLTSAIQLLRKDSSTKNGSLCYKVYHGMKDVSIGANVGST
IRFGQFLSASLLKEETRVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKSGS
PKGDLINLRSAGNMSTYNCQLLKACSKKCAPAPVVIGCLFLVTVVISSKSRAQRNLLAPF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtggcttccaggagggcagctcaccctgctgctactgctctgggtccagcag
acacccgcggggagcactgaggctcctcttaaggtcgacgtggacttgacacctgattcc
tttgatgatcaataccaaggctgtagcgaacagatggtggaggagctaaatcaaggagac
tatttcataaaggaagtagatactcataagtattactccagagcatggcaaaaagcccac
ctaacctggctgaaccaggcaaaggccctcccggagagcatgaccccggtgcatgctgtg
gccattgtggttttcaccctgaatctcaatgtgagctctgacttggccaaggccatggcc
agggctgcgggatctcctgggcagtacagtcagtcattccacttcaagtatctgcactac
tacctcacctcagccatccagctgctgaggaaagacagctctacaaagaacggcagtctg
tgttacaaggtgtaccacgggatgaaggatgtgagcattggagccaacgtaggttccacc
attcgattcggccagttcctctctgcctccctgctaaaggaagagacacgggtgtctgga
aaccaaaccctgtttaccattttcacttgtctgggtgcctctgtgcaagacttctctctc
aggaaggaagtcttgatccccccctatgagttatttgaagtcgtaagtaagagcggcagc
cccaaaggagatttgataaacttgcggtctgctgggaacatgagcacgtataactgccag
ctgctaaaagcttgcagcaagaagtgcgcccctgctccagtggttatcggctgcctcttt
ttggtcactgttgttatctcgtccaaaagcagagcgcaaaggaatctactggctcctttt
taa

DBGET integrated database retrieval system