KEGG   Mus musculus (mouse): 109979Help
Entry
109979            CDS       T01002                                 

Gene name
Art3, 4930569O04Rik, ARTC3
Definition
ADP-ribosyltransferase 3 (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     109979 (Art3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 E2; 5 46.54 cM
AA seq 361 aa AA seqDB search
MKMGHFEMVTTLLAAAVLMDIFQVKAEVLDMAENAFDDEYLKCKSRMESKYIPQMKREEW
ANDALLRMVWDNAEIQWEARKAQLFLPRNFKDTYGIALTAYVNEAQEQTSFYHTFSSAVK
MAGLSRRRYIYNFPFKAFHFYLVRALQLLRRPCEKSYKTVVYSTSPDISFTFGEQNQARL
GNFTLAYSAKPETADNQRVLTIQTCFGVAVGKFLNKEDDSVVLIPLSEVFQVSRKGTSND
LVLQSINSTCSYYECAFLGGLKTENCIANAEYIDPRYLYNPDMDNQKLEDSGRNNLDPDR
MPEIKVLQTEENPLLPDEKPAPGLVPGPKSHPSASSGNTLLPSVMASTILLVASAVNFIE
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgggacattttgaaatggtcaccacgctgctggcagccgcagttctaatggac
atcttccaggtgaaggcggaagtgttagacatggcagagaacgcgtttgacgacgaatac
ctgaagtgcaaaagcagaatggaatcgaagtatattccgcagatgaagagggaggagtgg
gcaaacgatgcgctcctgcggatggtgtgggacaatgcggagatccagtgggaagcgcgg
aaggctcagctcttcctccctagaaacttcaaggacacctatggcatagctctgacggcc
tacgtgaatgaggctcaagagcagacttccttctaccacacattcagcagcgctgtgaag
atggccggcctgtcccgaagacggtacatctataacttcccgttcaaggcttttcatttt
tacttggtgagagccctgcagctgctgagacgaccttgcgagaaaagttacaaaactgtg
gtgtacagcacaagcccagacatttcattcacattcggagagcaaaaccaagccaggctg
ggtaacttcacgttggcgtattcagccaaaccggagacagccgacaaccaacgggtgcta
accatccagacctgctttggagtcgccgtgggaaagtttcttaataaagaagacgacagc
gttgttttaatacctctgagtgaggtttttcaagtgtcgaggaaaggaactagcaacgac
cttgtccttcagagcataaacagtacctgcagctactacgagtgcgcattcctcgggggt
ctgaaaacagaaaattgtatcgcgaacgcagaatatattgaccctaggtatctctacaac
ccagatatggacaatcagaagcttgaagactctggtaggaacaaccttgaccctgacaga
atgccagaaattaaagtgctacaaacagaggaaaatcctctcctgccggatgaaaagcct
gctccaggtctggttccaggtccgaaatcccatccctctgcatcctctggcaatacgctc
cttccatcagtcatggcatccaccattttactcgttgcttctgctgtaaacttcatcgag
ctatag

DBGET integrated database retrieval system