KEGG   Mus musculus (mouse): 110279Help
Entry
110279            CDS       T01002                                 

Gene name
Bcr, 5133400C09Rik, AI561783, AI853148, mKIAA3017
Definition
(RefSeq) breakpoint cluster region (EC:2.7.11.1)
  KO
K08878  
breakpoint cluster region protein [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Pathways in cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    110279 (Bcr)
   05220 Chronic myeloid leukemia
    110279 (Bcr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110279 (Bcr)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  BCR family
   110279 (Bcr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10 B5.3-C1; 10 38.49 cM
AA seq 1270 aa AA seqDB search
MVDSVGFAEAWRAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQPPDGAAEPRASAPRPPPAPADGADPAPVEESEARPDGE
GSPSKGRSASARRPAAAASADRDDRGPPTSVAALRSNFEKIRKGPAQPGSADAEKPFYVN
VEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQQSAGQGLGEAPRPHYRGRSSESS
CGLDGDYEDAELNPRFLKDNLINANGGNRPPWPPLEYQPYQSIYVGGMMVEGEGKSPLLR
SQSTSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPT
TYRMFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQCQVVVSEATIVGVRKTGQIWPSDG
DSTFQGEADSSFGTPPGYGCAADQAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSLASGA
LDPTKVSELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQ
QIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVA
METAEKCCQANAQFAEISENLRARSNKDVKDSTTKNSLETLLYKPVDRVTRSTLVLHDLL
KHTPSSHPDHSLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEG
ARKLRHIFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEALPNIPLVPD
EELDALKIKISQIKSDIQREKRANKGSKVMERLRKKLSEQESLLLLMSPSMAFRVHSRNG
KSYTFLISSDYERAEWRESIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHHIPLTINK
EDDESPGLYGFLHVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEE
FEIELEGSQTLRILCYEKCYNKMKMTKEDGESADKLMGKGQVQLDPQTLQDRDWQRTVID
MNGIEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERR
GMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFT
DEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLH
NLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSK
RQSILFSTEV
NT seq 3813 nt NT seq  +upstreamnt  +downstreamnt
atggtggactcggtgggcttcgccgaggcgtggagggcgcagttcccggactcggagccg
ccgcgcatggagctgcgctcggtgggtgacatcgagcaggagctggagcgctgcaaggcc
tccattaggcgcttggagcaggaggtgaaccaggagcgcttccgcatgatctacctgcag
acgctgctggccaaggagaagaagagctacgatcggcagcgctggggcttccgccgtgca
gcgcagccccccgacggcgccgccgagccccgagcgtccgccccgcgcccgccgcccgcg
cccgccgacggcgcagacccggcgcccgtcgaggagtccgaggcgcggccggacggagag
gggtcaccgagtaaggggcggtcagcgtccgcccgcaggccagcggctgctgcatcggcg
gaccgggacgaccgagggccccccaccagcgtggcggcgctcagatccaacttcgagaag
atccgcaagggacctgcccagcccggctctgccgacgccgagaagcccttctacgtgaac
gtcgagttccaccacgagcgcggcctggtgaaggtcaacgacaaagaggtgtccgaccga
atcagttccctgggcagccaggccatgcaaatggagcgcaagaagtcccagcagagcgcc
gggcagggcctgggggaagcacccagaccccattaccgtgggcgctcctcggaaagcagt
tgcggccttgacggtgactatgaggatgcagagttgaatccccgcttcctgaaggacaac
ctaataaatgccaacggcggcaacaggcccccttggccgcccctggagtaccaaccctac
cagagcatctatgtcggaggcatgatggtggaaggggagggcaagagccctctcctgcga
agccagagcacttcagagcaggagaaacgcctaacctggcctcgcaggtcctactcgcct
cggagtttcgaggacagcggaggtggctacacgccggactgcagctccaacgagaacctc
acctccagcgaggaggacttttcctctggccagtccagccgcgtgtcaccaagccccacc
acctaccgcatgttccgggacaagagccgctcaccctcgcagaattcgcagcagtccttt
gacagcagcagccccccgacgccacagtgccagaagcggcaccggcagtgccaggttgtg
gtgtctgaggctaccatcgtgggtgtccgcaagactgggcagatctggcccagtgatggg
gacagcacctttcaaggggaagcagattcctcgtttggaacaccacctggatatggctgt
gccgcagaccaggctgaggaacagcgccggcaccaggacgggctgccctacatcgatgat
tcaccttcttcctcgccacacctcagcagcaaaggcagaggcagcctggcctcaggcgcc
ctggatcccaccaaagtgagtgagctggatctggaaaagggcctggagatgagaaagtgg
gttttgtccggaatcctggccagcgaggagacgtacctgagccatctggaggccctgctg
ctgcccatgaagcctctgaaagccgctgccaccacctctcagcctgtgctgaccagccag
cagattgagaccattttcttcaaagtgcctgagctctacgagatccacaaggagttctac
gatgggctgttcccccgagtgcagcagtggagccaccagcagcgtgtaggggacctcttc
cagaagctggccagccagctgggtgtgtaccgagcctttgtggataactacggagtggcc
atggaaactgcagagaagtgctgtcaggccaacgctcagtttgcagaaatctctgagaac
ctgcgagccagaagcaacaaggatgtcaaggactcaactaccaagaactctttggaaact
ctgctctacaaacctgtggaccgggtgacgaggagcacgctagtccttcacgacttgcta
aaacacaccccgtccagccatcccgaccattccctgctgcaagacgccctccgaatctct
cagaacttcctgtccagcatcaacgaggagatcacgccccgccgacagtccatgacggtg
aaaaaaggagagcaccggcagctgctgaaggacagctttatggtagagctggtggagggg
gcccgcaagctgcgtcacatcttcctgttcactgacctgctcctctgcaccaagctgaag
aagcaaagtggaggcaaaacccagcaatatgactgtaaatggtacattccgctcacggac
ctcagcttccagatggtggatgaattggaggcactacccaacatccctctggtgccagat
gaggaactggatgccttgaagatcaaaatctcccaaatcaagagcgacatccaacgagag
aagagagcaaataagggcagcaaggtcatggagaggctgaggaagaagctgtcagagcag
gagtcactgctgctgttaatgtctcccagcatggccttccgcgttcacagtcgcaacggc
aagagttacacgttccttatttcctctgactatgagcgagccgagtggagagaaagcatc
cgagagcagcagaagaaatgtttcaaaagtttctctctgacatctgtggagctacaaatg
ctgaccaactcatgtgtaaaacttcagacggttcaccacattccactgaccatcaacaaa
gaagatgacgagtctcctggactctacggcttcctgcatgtcatcgtccactcagccacc
ggctttaagcagagctcaaatctctactgcaccctggaggtggattcctttggatatttt
gtgaataaagcaaagactcgagtctacagggacacaactgagccaaactggaatgaggag
tttgagatagagctagaaggctcccagaccctgcggatactatgttatgaaaagtgttac
aacaaaatgaagatgacgaaggaagatggtgagagcgcagacaagctcatggggaaaggc
caggtccagctggacccccaaaccctacaggacagagactggcagcggactgtcatcgac
atgaatggaattgaagtgaaactctccgtcaagttcacgagcagggagttcagcctgaag
agaatgccctcccgcaaacagacaggggtcttcggtgtcaagattgctgtagtcacaaag
agagagaggtccaaggtaccttacattgtgcgccagtgtgtggaagagatcgagcgccgg
ggtatggaggaggtgggcatctaccgagtgtctggagtggccacagacatccaggcactg
aaggcagcctttgatgtcaataacaaggatgtgtccgtgatgatgagcgagatggacgtg
aacgccattgccggcacgctgaagctctacttccgtgagctgcccgagcccctcttcacg
gatgagttctaccctaacttcgcagaaggcattgctctttcagaccccgtcgcaaaggag
agctgcatgctgaacctgctgctgtccctcccagaagccaacctgctcaccttcctcttc
ctcctggaccacctgaaaagggtagctgaaaaggagacggtgaacaagatgtccctgcac
aacctcgccacggtctttggccccacactgcttcggccctcagagaaggaaagcaagctc
cctgctaaccccagccagcccatcaccatgactgacagctggtccctggaggtcatgtcc
caggtccaagtgttgctgtacttcctgcagctggaggccatccctgcccctgacagcaag
agacagagcatcctgttttccactgaagtctaa

DBGET integrated database retrieval system