KEGG   Mus musculus (mouse): 110446Help
Entry
110446            CDS       T01002                                 

Gene name
Acat1, 6330585C21Rik, Acat
Definition
(RefSeq) acetyl-Coenzyme A acetyltransferase 1 (EC:2.3.1.9)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    110446 (Acat1)
   01212 Fatty acid metabolism
    110446 (Acat1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    110446 (Acat1)
   00630 Glyoxylate and dicarboxylate metabolism
    110446 (Acat1)
   00640 Propanoate metabolism
    110446 (Acat1)
   00650 Butanoate metabolism
    110446 (Acat1)
  Lipid metabolism
   00071 Fatty acid degradation
    110446 (Acat1)
   00072 Synthesis and degradation of ketone bodies
    110446 (Acat1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110446 (Acat1)
   00310 Lysine degradation
    110446 (Acat1)
   00380 Tryptophan metabolism
    110446 (Acat1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    110446 (Acat1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     110446 (Acat1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110446 (Acat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 C-D; 9 29.12 cM
AA seq 424 aa AA seqDB search
MAALVALHGVVRRPLLRGLLQEVRCLERSYASKPTLNEVVIVSAIRTPIGSFLGSLASQP
ATKLGTAAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPISTPCTTVN
KVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMSRGATPYGGVKLEDLIVKDG
LTDVYNKIHMGNCAENTAKKMNISRQEQDTYALSSYTRSKEAWDAGKFASEITPITISVK
GKPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTITAANASTLNDGAAALVLMTAEAAQR
LNVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVVLAN
IKMLEIDPQKVNIHGGAVSLGHPIGMSGARIVVHMAHALKPGEFGLASICNGGGGASALL
IEKL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctggtggctctgcacggcgtcgtccgcaggcctctgcttcgcgggctgctg
caggaagtaagatgcctggaacgaagttatgcatccaaacccactttgaatgaagtggtt
atagtaagtgctataagaactcccattggatccttcctgggcagccttgcctctcagccg
gccactaaacttggtactgctgcaattcagggagccattgagaaggcagggattccaaaa
gaagaagtgaaggaagtctacatgggcaatgtcatccaagggggtgaaggacaggcccct
accaggcaagcaacactgggcgcaggtttacctatttccactccatgcaccacagtaaac
aaggtttgtgcttcaggaatgaaagccatcatgatggcctctcaaagtcttatgtgtgga
catcaggatgtgatggtggcaggcgggatggagagcatgtccaatgtcccatacgtaatg
agcagaggagcaacaccatatggtggggtaaaacttgaagacctgattgtaaaagacggg
ctaactgatgtctacaataaaattcatatgggtaactgtgctgagaatactgcaaagaag
atgaatatctcacggcaggaacaggatacgtacgctctcagctcttacaccagaagtaaa
gaagcgtgggacgcagggaagtttgccagtgagattactcccatcaccatctcagtgaaa
ggtaaaccagatgtggtggtgaaagaagatgaagaatacaagcgtgttgactttagtaaa
gtgccaaagctcaagaccgtgttccagaaagaaaatggcacaataacagctgccaatgcc
agcacactgaacgatggagcagctgctctggttctcatgactgcagaggcagcccagagg
ctcaatgttaagccattggcacgaattgcagcatttgctgatgctgccgtagaccccatt
gattttccacttgcgcctgcatatgccgtacctaaggttcttaaatatgcaggactgaaa
aaagaagacattgccatgtgggaagtaaatgaagcattcagtgtggttgtgctagccaac
attaaaatgctggagattgacccccaaaaagtaaatatccacggaggagctgtttctctg
ggccatccaattgggatgtctggagcccggattgttgttcatatggctcatgccctgaag
ccaggagagttcggtctggctagtatttgcaacggaggaggaggtgcttccgccctgctg
attgagaagctgtag

DBGET integrated database retrieval system