KEGG   Mus musculus (mouse): 110637Help
Entry
110637            CDS       T01002                                 

Gene name
Grik4, 6330551K01Rik, GluK4, GluRgamma1, KA-1, KA1
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110637 (Grik4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    110637 (Grik4)
Ion channels [BR:mmu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   110637 (Grik4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 A5.1; 9 23.8 cM
AA seq 956 aa AA seqDB search
MPRVSAPLVLLPAWLLMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVRFQLQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFSQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFQQIGQWHVAEGLSMDSRLYASNISDSLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRRPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEASEVS
VCQEMVTELRNIILCQDNIHPRRRRSGGLPPQPPVLEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWDKTTNSSEPE
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgtctccgctcctctggtgctgcttcctgcttggctcttgatggtggcctgt
agcccacactccctgaggattgctgctatcttggatgaccccatggagtgcagcagaggg
gaacggctctccatcaccctggccaagaaccgtatcaaccgcgcaccagagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtacgaaactgca
gaaaccatgtgtcagatcctccccaagggtgtggtcgctgtcctgggaccatcgtccagc
ccagcctccagctccatcatcagcaacatctgtggagagaaggaggtccctcatttcaag
gtggccccagaggaatttgtcaggttccaactccagagattcaccaccctgaaccttcac
cccagcaacaccgacatcagcgtggctgtggctgggatcctgaacttcttcaactgcacc
accgcctgcctcatctgtgccaaagcagaatgccttttaaacctggagaagctgctccga
caattccttatctccaaggacacactctcggtccggatgttggacgacacacgggacccc
actccactcctcaaggagatccgggatgacaagacagctactatcatcatccacgccaac
gcctccatgtcgcacaccatcctcctgaaggcagctgaactggggatggtgtcagcctat
tacacatacatcttcaccaatctggagttctccctccagagaatggacagccttgtggat
gatagagtcaacatcttaggattttccattttcaaccaatcccatgcattcttccaagag
ttctcccagagcctcaaccaatcctggcaggagaactgtgaccatgtgcccttcaccggc
cctgcgttgtcctcagccctgctgtttgacgctgtctatgctgtggtgacagcggtacag
gaactgaaccggagccaagagattggtgtgaagcccctgtcctgtggctcagcccagatc
tggcagcatggcaccagcctcatgaactaccttcgcatggtagaattggaaggtcttacc
ggccacattgaattcaacagcaaaggccagaggtccaactatgccttgaaaatcttacag
ttcaccaggaatgggtttcagcagattggccagtggcatgtggcagagggcctcagcatg
gacagccgcctctacgcctccaacatctctgacagtctcttcaacaccaccctggtcgtc
accaccatcctggaaaacccatacttaatgctgaaggggaaccaccaggagatggaaggc
aatgaccgatatgagggattctgtgtggacatgctcaaggagttggctgagatcctacgg
ttcaactacaagatccgccttgttggggatggtgtttacggcgtacctgaggccaacggc
acctggacaggcatggttggggagctgatcgctcggaaagcggatctggctgtggcgggc
ctcaccatcacagcggaacgtgagaaagtgatcgatttctccaagccattcatgacgctg
ggaattagtattctttacagagttcatatgggacgcagaccgggctatttctccttcctg
gatcccttttctccaggagtctggctcttcatgcttctagcttatctggcggtcagctgt
gtcctcttcctggtggctcggttgactccttatgagtggtacagtccacatccttgtgcg
cagggccggtgtaatctcctggtcaaccagtactccctgggcaacagcctctggtttccg
gttggaggcttcatgcagcaaggctccactattgcccctcgagctttgtctacccgctgt
gtcagtggtgtctggtgggcattcacgttgatcatcatctcctcctacacggccaacctg
gcagccttcctgactgtgcagcgcatggaggtgcccattgagtctgtggatgacctggct
gaccagactgccattgagtatggcacgattcatggaggctccagcatgaccttcttccaa
aattcccgttaccagacctaccaacgcatgtggaactacatgtactccaagcagccgagt
gtgttcgtgaagagcacggaggaggggattgccagagtgttgaattccaattacgccttc
ctgctggagtctaccatgaatgagtactaccggcagcgaaactgcaacctcactcagatt
gggggcctgctggacaccaagggctatgggattggcatgccagtcggctcagtgttccgg
gatgagttcgacctggccattctccagctgcaggagaacaaccgcctggaaattctgaag
cggaagtggtgggaagggggaaaatgtcccaaggaggaggaccatcgagccaaaggcctg
ggaatggagaatattggtggaatctttgtggttcttatttgtggcttaatagtggccatt
tttatggctatgctggagtttttgtggactctcagacactcagaagcatcagaggtgtct
gtgtgtcaggagatggtgacagaactgcgcaacatcatcctgtgccaggacaatatccat
cccaggcggcggcgctctggaggcctgccaccccagcccccggtcctggaggagcgccga
cccagaggcacagcgacgctcagcaatggcaagctatgtggcgccggggagccagaccag
ctggcgcagagactggcacaggaggccgccctagtagctcgaggctgcacgcacatccgc
gtgtgcccagagtgccgccgcttccagggcctgcgggcgcgaccgtcgccagcgcgcagc
gaggagagcctggagtgggacaagaccaccaacagcagcgagcccgagtag

DBGET integrated database retrieval system