KEGG   Mus musculus (mouse): 110842Help
Entry
110842            CDS       T01002                                 

Gene name
Etfa, 2010200I21Rik, D9Ertd394e
Definition
(RefSeq) electron transferring flavoprotein, alpha polypeptide
  KO
K03522  
electron transfer flavoprotein alpha subunit
Organism
mmu  Mus musculus (mouse)
Brite
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   110842 (Etfa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 B
AA seq 333 aa AA seqDB search
MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAAGRLGGEVSCLVAGTKC
DKVVQDLCKVAGVAKVLVAQHDAYKGLLPEELTPLILETQKQFSYTHICAGASAFGKNLL
PRVAAKLNVAPVSDIIEIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAATSG
GSASSEKAPSSSSVGISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQ
LHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAIN
KDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgagcagcggcgcctgggcagctccggcgggcggcctcattgctccgttttcag
agtaccttggtaatagctgagcatgcaaatgattccctagcacccattactctaaatact
atcactgcagctggacgtcttggaggtgaagtgtcctgcttagtagctggaaccaagtgt
gacaaggtggtacaggatctatgtaaagtagctggcgtagcaaaggttctggtggctcag
catgatgcatacaaaggccttcttccagaggaactcacaccattgattttggaaactcag
aagcagttcagttacacacacatctgtgctggagcgtctgcttttggaaagaaccttctg
cccagagtagctgccaaacttaatgttgctccagtttctgacatcattgagatcaagtca
cctgacacatttgtgagaactatctatgcaggaaatgcgttgtgtacagtaaagtgtgat
gagaaagtaaaggtgttttctgttcgaggaacatcttttgaggctgcagcaacaagtgga
ggtagtgctagttcagaaaaggcaccaagttcttcatcagtgggaatatcagagtggctt
gaccagaaattgacaaaaagtgaccgaccagaactaactggtgccaaagtggtggtatct
ggtggtcggggtttgaagagtggagagaactttaaactgctgtatgacctggcagatcaa
ctacatgctgcagttggtgcttcccgagctgctgttgatgctggctttgttcccaatgac
atgcaagttggtcagacaggaaaaatagtagctccagaactttatattgctgtaggaata
tctggagccattcaacatttagctgggatgaaggacagcaagacaatcgtggctattaac
aaagatccagaagctccaattttccaggtggcagattatggaatagttgcagatttattt
aaggtggttcctgaaatgacagaaatactgaagaaaaaataa

DBGET integrated database retrieval system