KEGG   Mus musculus (mouse): 110880Help
Entry
110880            CDS       T01002                                 

Gene name
Scn4a, Nav1.4, SkM1, mH2
Definition
(RefSeq) sodium channel, voltage-gated, type IV, alpha
  KO
K04837  
voltage-gated sodium channel type IV alpha
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   110880 (Scn4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E1; 11 68.91 cM
AA seq 1841 aa AA seqDB search
MASSSLPTLVPPGPHCLRPFTPESLAAIEQRAMEEEARLQRNKQMEIEEPERKPRSDLEA
GKNLPLIYGDPPPEVIGVPLEDLDPYYSDKKTFIVLNKGKAIFRFSATPALYMLSPFSIV
RRVAIKVLIHALFSMFIMITILTNCVFMTMSNPPSWSKDVEYTFTGIYTFESLIKMLARG
FCIDDFTFLRDPWNWLDFSVITMAYVTEFVDLGNISALRTFRVLRALKTITVIPGLKTIV
GALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVRWPPPMNDTNTTWYGNDTW
YGNDTWYGNDTWYGNDTWNSQESWVSNSTFDWEAYINDEGNFYFLEGSNDALLCGNSSDA
GHCPEGYECMKAGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIF
FVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEDQEKEEEFQQMLEKFKKHQEELEKAK
AAQALEGGEEADGDPTHSKDCNGSLDTSGEKGPPRPSCSAESAISDAMEELEEAHQKCPP
WWYKCAHKVLIWNCCAPWVKFKHIILLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHF
DNVLSVGNLVFTGIFTAEMVLKLIAMDPYEYFQQGWNIFDSFIVTLSLVELGLANVQGLS
VLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY
KECVCKIASDCSLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVM
VIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKWGIAFAKTFLLGLLHG
KILSLKDIMLSLGEPGGAGENGESPPEDEKKEPPPEDGNKELKDNHILNHVGLTDGPRSS
IEMDHLNFINNPYLTIHVPIASEESDLEMPTEEETDTFSEPEDIKKPLQPLYDGNSSVCS
TADYKPPEEDPEEQAEENPEGELPEECFTEACVKRCPCLYVDISQGRGKMWWTLRRACFK
IVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIQTILEYADKVFTYIFILEMLLKWVA
YGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGM
RVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISVVNNK
SECESLMYTGQVRWMNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQPDYE
VNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGKDIFMTEEQKKYYNAMKKL
GSKKPQKPIPRPQNKIQGMVYDFVTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILY
NINMVFIIVFTGECVLKMFALRHYYFTIGWNIFDFVVVILSIVGLALSDLIQKYFVSPTL
FRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAY
VKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPTLENPGTNIKG
DCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLCEDDFEMFYETWEK
FDPDATQFIDYSRLSDFVDTLQEPLKIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKE
VLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKQEEVCAIKIQRAYRRHLLQRS
VKQASYMYRHSQEGNGDGAPEKEGLLANTMNKMYGSEKEDNGVQSQGEKEKDSTEDAGPT
TEVTAPSSSDTALTPPPPSPPPPSSPPQGQTVRPGVKESLV
NT seq 5526 nt NT seq  +upstreamnt  +downstreamnt
atggccagctcatctctgcccaccctggtcccccctggtccccactgcctgcgccccttc
accccagagtccctggcagccatagaacagcgggcaatggaggaggaagcccggctgcag
cggaacaagcaaatggagattgaagagcctgagcggaagccacgcagtgacctggaagct
ggcaagaacctcccactcatctatggggaccccccacctgaagtcattggcgtccccctg
gaggacctggacccttactacagtgacaagaagaccttcattgtgctcaacaaaggaaag
gccatcttccgattctctgccacccctgccctctacatgctgagccccttcagcatcgtc
cggcgggtggctatcaaggtgctcatccacgcgctgttcagcatgttcatcatgatcacc
atcttgaccaactgcgtgttcatgaccatgagcaacccgccttcttggtccaaggacgtg
gagtacaccttcacagggatctacacctttgagtccctcattaagatgctggcccgaggc
ttttgcattgatgacttcacattcctccgagacccctggaactggctggacttcagtgtc
atcacaatggcgtacgtgacagagtttgtggacttgggcaacatctcagccctgaggacc
ttccgtgtgctgcgggccctgaaaaccatcacggtcatcccagggctgaagacgatcgtg
ggagccctgatccagtctgtgaaaaagctctcggatgtgatgatcctcactgtcttctgc
ctgagcgtctttgccctggtggggctgcagcttttcatgggaaacctgcgtcagaagtgc
gtgcgttggcccccgcccatgaatgacaccaacaccacgtggtatggtaatgatacgtgg
tacggcaatgacacctggtacggcaatgacacctggtatggcaatgacacttggaacagc
caggagagctgggtcagcaactctacctttgactgggaggcctacatcaatgacgaaggg
aacttctatttcttggagggctccaatgatgccctgctctgtgggaatagcagtgatgcc
gggcactgccctgagggctacgaatgcatgaaggctgggaggaaccccaactatggctac
accagctacgacaccttcagctgggccttcctggctctcttccgtctcatgacgcaggac
tactgggagaaccttttccagctgacccttcgagccgctggcaagacctacatgatcttc
tttgtggtcatcatcttcctgggttccttctacctcatcaatctgatcctggcggtggtg
gccatggcatatgctgagcagaatgaggctaccctggccgaagaccaggagaaagaggag
gagttccaacagatgcttgaaaaattcaaaaaacatcaggaggaactggaaaaggcgaag
gctgcccaggctctggaaggtggagaggaggcagatggggacccaacccacagcaaagac
tgcaatggtagcctggatacatccggggagaaggggcccccaaggccaagctgcagcgca
gagagtgccatctcagatgctatggaggagctggaagaggcccatcagaagtgcccccca
tggtggtacaagtgtgcacacaaagtgctcatctggaactgctgtgccccgtgggtgaag
ttcaagcatattatcctcctgattgtcatggacccctttgtggacctgggcatcaccatc
tgcatcgtgctcaacaccctcttcatggccatggagcactaccccatgactgagcacttt
gacaacgtgctctctgtgggcaacttggtcttcacgggcatcttcactgcagagatggtg
ctgaagttgattgctatggacccctacgaatatttccaacagggctggaacatcttcgac
agcttcatcgtcaccctcagcctggtggagctgggcctggccaacgtgcagggcctatca
gtgctccgttctttccgtctgctgcgtgtcttcaagctggccaagtcatggccaacactc
aacatgctcatcaaaatcattggcaactcagtgggtgcgctgggcaacctgaccctggtg
ttggccatcatcgtcttcatcttcgccgtggtgggcatgcagctgtttggcaagagctat
aaggaatgcgtgtgcaagattgcctcagactgcagcctgccccgctggcacatgcacgat
ttcttccactccttcctcatcgtcttccgcatcctctgtggggagtggatcgagaccatg
tgggactgcatggaagtggccggccaggccatgtgcctcaccgtcttcctcatggtcatg
gtcattggcaacctggtggtcctgaatctgttcctggctctcctgttgagttccttcagc
gctgacagtctggcagcgtcagatgaagatggtgagatgaacaacctacagatcgccatc
gggcgtatcaagtggggcatcgcctttgccaaaaccttcctcttggggctgttgcatggc
aagatcctgagcctcaaagacataatgctcagtctcggggagcctgggggtgctggggaa
aacggggagagccctcccgaggatgagaagaaggaaccacctccggaagatgggaacaag
gagctgaaagacaatcatatcctgaaccacgtgggcctgactgatggaccccgctccagc
atcgagatggaccaccttaacttcatcaacaacccctacctcactatccatgtgcccatt
gcctccgaggagtccgacttggaaatgcccacagaggaggagactgacaccttctcggag
cctgaggacatcaagaagccactacagcctctgtacgacgggaactcctccgtctgcagc
acagctgactacaagccccccgaagaggaccctgaggagcaggctgaggagaaccctgag
ggggagctacctgaggagtgtttcacagaggcctgtgtgaagcgctgcccctgcctctat
gtggacatctcccagggccgcgggaaaatgtggtggacactccgcagggcctgcttcaag
attgttgagcacaactggtttgagaccttcatcgtcttcatgatcttgctcagcagcggg
gccctggccttcgaggacatctacattgaacagcggcgagtcatccaaaccatcctggaa
tatgctgacaaggtcttcacctacatcttcatcctggagatgctgctaaagtgggtggcc
tacggcttcaaggtgtacttcaccaacgcctggtgctggctcgacttcctcattgtggat
gtctccatcatcagtctggtggctaactggctgggctactctgagctggggcccatcaaa
tccctgcgcacgctccgggccctgcgacctctgagggcactgtcccgatttgaaggcatg
agggtggtggtgaacgcccttctgggagccatcccttccatcatgaacgtgctccttgtc
tgcctcatcttctggctcatcttcagcatcatgggggtcaacttgtttgctggaaagttc
tactactgcatcaacacaaccacctccgagagattcgacatctctgtggtcaacaacaag
tccgagtgtgagagcctcatgtacaccggccaggtccgctggatgaacgtcaaggtcaac
tatgacaacgtgggtctcggctacctctctcttcttcaggtggccactttcaagggttgg
atggacatcatgtatgcagctgtggactcccgggagaaagaggagcagccagactacgag
gtgaacctctacatgtacctttacttcgtcatctttatcatcttcggctccttcttcacc
ctcaatctcttcattggcgtcatcattgacaacttcaaccaacagaagaagaagtttgga
gggaaagacatcttcatgacagaggaacagaagaaatactacaatgcgatgaagaagctt
ggctccaagaagccccagaagccaatcccccggcctcagaacaagatccaaggcatggtg
tacgacttcgtgacaaagcaggtgtttgacatctctatcatgatcctcatctgcctcaac
atggtgacgatgatggtggagacggatgaccagagccagctcaaggtggacatcctgtat
aacatcaacatggtcttcattatcgtcttcacaggggagtgtgtgctcaagatgtttgcc
ctgcgccattactacttcaccattggctggaatatcttcgacttcgtggttgtcatcttg
tccattgtgggtctcgcactctctgacttgatacagaaatactttgtgtcacccacactg
ttccgtgtgatccgattggctcggatcgggcgtgtcttgcgtctgatccgtggggccaag
ggcatccggacgctgctgttcgccctgatgatgtccctgcccgccctcttcaacatcggc
ctccttctctttctggtcatgttcatttactccatcttcggcatgtctaacttcgcctac
gtcaagaaagagtcgggcatcgacgacatgttcaactttgagacctttggcaacagtatc
atctgcctcttcgagatcaccacgtcagctggctgggacgggcttctgaaccccatcctc
aacagtgggcccccagactgtgacccgacattggagaacccaggcaccaatatcaagggt
gactgcggcaacccatccatcggcatctgtttcttctgcagctacatcatcatctccttc
ctcatcgtggtcaacatgtacattgccatcatcctagagaatttcaatgtggccactgaa
gagagcagtgagcccctctgtgaggatgacttcgagatgttctatgagacctgggagaag
tttgaccccgatgcaactcagttcatcgactacagccgcctttctgactttgtggacacc
ctgcaggagcccttgaaaattgccaagcccaataagatcaagcttatcacattagacctg
cccatggtacccggggacaagatccactgcctggacatcctctttgccctgaccaaagag
gtactgggtgactctggggaaatggatgctctcaaacagaccatggaggagaagttcatg
gcagctaacccctccaaggtctcctatgagcccatcaccaccaccctcaagaggaagcag
gaggaggtgtgtgctatcaaaatccagagggcttaccgccgccatctgctgcagcgctct
gtgaagcaggcctcttacatgtaccgccacagccaggaaggcaatggcgatggggcccct
gagaaggagggattgcttgccaacaccatgaacaagatgtatggctctgagaaagaggac
aacggtgtgcagagccagggggagaaagagaaagactcaacagaggatgctggacccacc
acggaggtcacagcccccagcagctcggacactgccctgactcctcctcctccttctcct
cctccaccatcatcaccaccacaagggcagacagtgcgcccaggggtcaaagagtctctt
gtctag

DBGET integrated database retrieval system