KEGG   Mus musculus (mouse): 112417Help
Entry
112417            CDS       T01002                                 

Gene name
Ugt2b37, 0610033E06Rik
Definition
UDP glucuronosyltransferase 2 family, polypeptide B37
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    112417 (Ugt2b37)
   00053 Ascorbate and aldarate metabolism
    112417 (Ugt2b37)
   00500 Starch and sucrose metabolism
    112417 (Ugt2b37)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    112417 (Ugt2b37)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    112417 (Ugt2b37)
   00860 Porphyrin and chlorophyll metabolism
    112417 (Ugt2b37)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    112417 (Ugt2b37)
   00982 Drug metabolism - cytochrome P450
    112417 (Ugt2b37)
   00983 Drug metabolism - other enzymes
    112417 (Ugt2b37)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    112417 (Ugt2b37)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     112417 (Ugt2b37)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   112417 (Ugt2b37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 E1; 5
AA seq 530 aa AA seqDB search
MPGKWISALLLLQISCCFRSVKCGKVLVWPMEFSHWMNIKIILDELVQRGHEVTVLRPSA
YYVLDPKKSPGLKFETFPTSVTKDDLENFFIQLLNVWTYELSRDTCLSYSPLMQNMFDEL
SGYYLSLCKDVVSNRQLMTKLQESKFDVLLSDPVAFGGELIAELLHIPFLYSLRFTAGYR
IEKSSGRFLLPPSYVPVILSGLGGQMTFIERVKNMICMLYFDFWFQMPNDKKWDSFYTEY
LGRPTTLAETMGQAEMWLIRSNWDLEFPHPTLPNVDYVGGLHCKPAKPLPKDMEEYVQSS
GDHGVVVFSLGSMVSNITEEKVNAIAWALAQIPQKVLWKFDGKTPATLGHNTRVYKWLPQ
NDLLGHPKTKAFITHGGANSVYEAIYHGIPMIGIPLFGEQHDNIAHMVAKGAAVTLNIRT
MSRSDVLNALEEVIENPFYKKNAMWLSTIHHDQPMKPLDRAVFWVEFVMRHKNAKHLRPL
GHNLTWYQYHSLDVIGFLLACVAATVVLTVKCLLFIYRFFVTKKKKMKNE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaaagtggatttctgctctgttgctgctgcagataagttgctgcttcagatct
gtgaaatgtgggaaagtgttggtgtggccgatggaattcagtcattggatgaacataaaa
ataatactggatgaactggtacagaggggccatgaagtcactgttctgagaccttcagct
tactatgttcttgatcccaaaaaatcacctggccttaagtttgaaacttttcctacatct
gtcactaaagatgatctggaaaattttttcatacagcttttgaatgtgtggacttatgag
ttgtcaagagatacatgtttgtcatattctcctttaatgcaaaatatgtttgatgaatta
tctggttattatctaagtctttgtaaagatgtcgtttcaaacagacagctcatgacaaag
ctacaggaatcaaagtttgatgtccttttgtcagatcctgttgcttttggtggggagcta
atcgctgaattgctccacataccttttctgtacagtcttcgcttcactgcaggttacaga
attgaaaaatccagtggaagatttctactacctccctcttatgtgcctgttattctgtca
ggattaggtggacaaatgacattcatagagagagtaaaaaatatgatatgcatgctttat
tttgacttttggttccagatgcctaatgataagaaatgggattcattttacactgaatat
ttgggaaggcccaccaccttagctgagacaatgggccaagcagaaatgtggctcattaga
tccaactgggatttggagtttcctcacccgaccttaccaaatgttgactatgttggagga
ctccactgcaaacctgctaaacctttgcctaaggatatggaagaatatgtccagagctct
ggagaccatggtgtagtggtcttttctcttgggtcaatggttagtaacatcacagaagaa
aaagtcaacgcaattgcatgggcccttgcccagattccacaaaaggttctttggaaattt
gatggcaaaaccccagcaactttaggacacaatacaagagtgtacaagtggctcccccag
aatgacctccttggtcatccaaaaaccaaagcctttataactcatggtggggccaacagt
gtctatgaggcaatctatcatggaatccctatgattggcattcctttgtttggagaacag
catgataacattgcccatatggtggccaaaggagcagctgttacattgaatatcagaaca
atgtcaaggtcagatgtgctcaatgcactggaggaagtcatagaaaatcctttctataaa
aagaatgctatgtggttgtcaaccattcaccatgaccagcctatgaaacccctggacagg
gctgtattctgggttgagtttgtcatgcgccacaaaaatgctaagcacttgaggccactt
ggacataaccttacctggtaccagtaccactctctggatgtgattggattcctactcgct
tgtgtggcagccactgtagttcttactgtaaagtgcctcttgttcatttaccgattcttt
gtaacgaaaaaaaagaaaatgaagaatgagtag

DBGET integrated database retrieval system