KEGG   Mus musculus (mouse): 11302Help
Entry
11302             CDS       T01002                                 

Gene name
Aatk, AATYK, aatyk1, mKIAA0641
Definition
(RefSeq) apoptosis-associated tyrosine kinase (EC:2.7.11.1)
  KO
K17480  
lemur tyrosine kinase 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     11302 (Aatk)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Lmr family [OT]
   11302 (Aatk)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     11302 (Aatk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 E2
AA seq 1374 aa AA seqDB search
MLIALLALAMSSSFFNPSFAFSSHFDPDGAPLSELSWSSSLAVVAVSFSGIFTVVILMLA
CLCCKKGGIGFKEFENAEGDEYVADFSEQGSPAAAAQTGPDVYVLPLTEVSLPMAKQPGR
SVQLLKSTDLGRHSLLYLKEIGHGWFGKVFLGEVHSGVSGTQVVVKELKVSASVQEQMQF
LEEAQPYRALQHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVTESMAPDPLTL
QRMACEVACGVLHLHRHNYVHSDLALRNCLLTADLTVKVGDYGLSHCKYREDYLVTADQL
WVPLRWIAPELVDEVHGNLLVVDQTKSSNVWSLGVTIWELFELGAQPYPQHSDGQVLAYA
VREQQLKLPKPQLQLALSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGTTELEEEF
ERRWRSLRPGGSTGLGSGSAAPAAATAASAELTAASSFPLLERFTSDGFHVDSDDVLTVT
ETSHGLNFEYKWEAGCGAEEYPPSGAASSPGSAARLQELCAPDSSPPGVVPVLSAHSPSV
GSEYFIRLEGAVPAAGHDPDCAGCAPSPQAVTDQDNNSEESTVASLAMEPLLGHAPPTEG
LWGPCDHHSHRRQGSPCPSRSPSPGTPMLPAEDIDWGVATFCPPFFDDPLGASPSGSPGA
QPSPSDEEPEEGKVGLAAQCGHWSSNMSANNNSASRDPESWDPGYVSSFTDSYRDDCSSL
EQTPRASPEVGHLLSQEDPRDFLPGLVAVSPGQEPSRPFNLLPLCPAKGLAPAACLITSP
WTEGAVGGAENPIVEPKLAQEAEGSAEPQLPLPSVPSPSCEGASLPSEEASAPDILPASP
TPAAGSWVTVPEPAPTLESSGSSLGQEAPSSEDEDTTEATSGVFTDLSSDGPHTEKSGIV
PALRSLQKQVGTPDSLDSLDIPSSASDGGCEVLSPSAAGPPGGQPRAVDSGYDTENYESP
EFVLKEAHESSEPEAFGEPASEGESPGPDPLLSVSLGGLSKKSPYRDSAYFSDLDAESEP
TFGPEKHSGIQDSQKEQDLRSPPSPGHQSVQAFPRSAVSSEVLSPPQQSEEPLPEVPRPE
PLGAQGPVGVQPVPGPSHSKCFPLTSVPLISEGSGTEPQGPSGQLSGRAQQGQMGNPSTP
RSPLCLALPGHPGALEGRPEEDEDTEDSEESDEELRCYSVQEPSEDSEEEPPAVPVVVAE
SQSARNLRSLLKMPSLLSEAFCDDLERKKKAVSFFDDVTVYLFDQESPTRETGEPFPSTK
ESLPTFLEGGPSSPSATGLPLRAGHSPDSSAPEPGSRFEWDGDFPLVPGKAALVTELDPA
DPVLAAPPTPAAPFSRFTVSPTPASRFSITHISDSDAQSVGGPAAGAGGRYTEA
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcgcgctgctggccctggccatgtcgtcgtccttcttcaaccccagctttgcc
ttcagctcccacttcgacccggacggtgccccgctcagtgagctgtcctggtcctcgtcc
ctcgcggtggtagccgtgtccttctctggaatcttcactgtcgtcatcctcatgctggcc
tgcctgtgttgtaagaagggcggcatcgggttcaaggagtttgagaatgctgaaggggac
gagtatgtggccgacttctcggagcagggctccccggctgcagctgcacagaccggcccc
gatgtgtatgtcctgcccctcaccgaggtctccttacccatggccaagcagccgggtcgc
tccgtgcaacttctcaagtccacggacctgggccggcacagcctcctgtacttaaaggag
attggccacggctggtttgggaaggtgtttttgggggaggtacactcgggcgtcagtggc
acgcaggtggtggtgaaggagctgaaggtgagcgccagcgtgcaggagcagatgcagttc
ctggaggaggcgcagccctacagggccctgcagcacagcaacctgctccagtgcctggcc
cagtgtgctgaagtgaccccctacctgctggttatggagttctgtccactgggggacctc
aaaggttatctacggagctgccgggtgacagagtccatggcgcctgacccacttaccttg
cagcgcatggcgtgcgaggtggcgtgtggcgtcttgcatctacatcgacacaactatgta
cacagtgacctggccctgaggaactgcctgcttacggctgacctgacagtgaaggttggt
gattatggcctgtcgcattgcaaatacagggaagactatctcgtgaccgctgaccagctg
tgggtgccgctgcgctggatcgcgccagagctggtggacgaggttcacggcaacctgctg
gtggtggaccagaccaagagcagcaacgtgtggtccctgggtgtgaccatctgggagctt
ttcgagttgggtgcgcagccgtacccccagcactcggacgggcaggtgctggcttacgcc
gtccgggagcagcagcttaagttgcccaagccccagctgcagctggctctatctgatcga
tggtacgaggtgatgcagttctgctggctgcagccagagcagaggcccacagctgaagag
gttcatctactgctgtcctacttgtgtgctaagggcaccacagaattggaggaggagttt
gagcggcgctggcgctccctgcggcccgggggcagcacgggcctgggctcgggttctgca
gccccagcagctgccaccgccgcctccgcggagctcaccgctgcctcgtctttcccgctg
ctggagcggttcaccagcgacggctttcacgtggacagtgatgacgtgctgacggtcacg
gagacaagccacggcctcaactttgaatacaagtgggaggctggctgtggcgctgaggag
tacccaccctcgggggctgcatcaagcccaggctcggcagcgcgcctgcaggagttgtgc
gcgcctgacagttcaccgccgggtgtggtgccagtcctcagtgcccacagcccctcagtg
ggtagcgagtacttcatccgcctggagggggcagtgcctgctgctggccacgatccagac
tgtgccggctgcgctcccagcccccaggctgtgactgaccaggacaataactctgaggag
agcactgttgcgtcccttgccatggagccattgctgggccatgcacccccaactgagggt
ctgtggggcccctgtgaccaccattcacataggaggcaagggtcaccctgtccctcacgc
tcaccctctcctgggaccccgatgttgccagctgaagacatagactggggtgtggctacc
ttctgcccgcccttctttgatgacccactgggtgcatctccctcggggagtcctggggcc
cagccctcccccagtgatgaggagccagaggaggggaaggtggggttggccgctcagtgt
ggacactggagctctaacatgtcagctaacaacaacagtgccagtcgcgacccagaatcc
tgggatcctggctatgttagcagcttcacagacagctacagggacgactgctccagctta
gagcagacccctcgagcctcccctgaggtgggccatctcctgtcccaggaggatcccaga
gattttctccctgggctagtagcagtctcccctggtcaggagccaagccgtcccttcaac
ctgctccccctgtgtcctgccaaaggcctggcacctgctgcctgcctcatcacatcccct
tggacagagggagctgtgggtggggctgagaaccccattgtggaacccaaacttgcccag
gaggctgagggatctgctgaaccccagctaccccttccttccgtcccctccccatcctgt
gaaggagcctcacttccctcggaggaggcaagcgctcctgacatcctacctgcctcaccc
acacccgctgctggcagctgggtgaccgtccctgagccagcccccaccctggagagcagc
ggcagttctctggggcaagaggcacccagcagcgaggacgaagacacgaccgaggcaaca
tcaggagtcttcaccgacctgtccagtgacggcccacacacggagaagtcaggcatagta
ccagccttgcgcagtctgcagaagcaggtggggacccctgactccctggactctctggac
ataccgtcctcagccagtgatggtggctgtgaggtcttaagcccatcagctgctggtcca
cctggcgggcagccccgtgccgtggacagtggctatgatacagagaactatgagtctcct
gagtttgtgctcaaggaggcccatgagtcgagtgagcctgaggcctttggggagccagcc
tcagagggtgagagcccagggcccgatcctctgctctctgtctcccttggtggcctcagc
aagaagagcccctaccgagactctgcctacttttcagacctggatgccgagtccgaaccc
acctttggccctgagaagcacagtgggatccaggactcccaaaaggagcaagacctgagg
agcccacctagcccagggcatcagtctgtgcaggcttttcccaggtctgcagtgtccagc
gaggtgctgtcccctccacagcagtcagaggagcccttgccagaagtccccaggccagag
cctctcggggctcaaggcccagttggagtgcagcctgtgcccggcccaagtcattccaaa
tgtttcccgctgacctccgttccactgatctcagaaggcagtggcacggagccccagggt
ccctcaggacagctgtcagggcgagcccagcaggggcagatgggcaatcctagcacaccc
agatccccgctctgcctggccctgcctggccaccccggggctttggagggccggccggag
gaggatgaggacaccgaggacagcgaggagtctgatgaggagctccggtgctacagcgtc
caggagcccagtgaggacagcgaggaggagccgccagcggtgcccgtggtggtggctgag
agccagagtgcccgaaatctacgcagcctgctgaagatgcccagcctgctgtcagaggcc
ttctgtgacgacctggagcgcaagaagaaggctgtgtccttcttcgatgatgtcacggtc
tacctctttgaccaggaaagccccacccgagagactggggagccctttcccagcacaaag
gaatcactccctacgttcctggagggtggccccagctcacccagtgccaccggcctgcca
ctgcgggctggccactctcctgacagctctgctcctgaaccaggcagtaggttcgaatgg
gatggtgatttcccgttggtgcccggcaaggctgctttggtgactgagctggatcctgct
gaccctgtcctggcggcgcctcccacgccagctgcgcccttctcacgcttcaccgtgtca
cccacacctgcctcccgcttttccatcacccacatatctgactcagatgcccagtccgtg
ggaggcccagcagcaggtgctgggggccgatacacagaggcttga

DBGET integrated database retrieval system