KEGG   Mus musculus (mouse): 11305Help
Entry
11305             CDS       T01002                                 

Gene name
Abca2, AI413825, Abc2, D2H0S1474E, mKIAA1062
Definition
ATP-binding cassette, sub-family A (ABC1), member 2
Orthology
K05642  
ATP-binding cassette, subfamily A (ABC1), member 2
Organism
mmu  Mus musculus (mouse)
Pathway
ABC transporters
Lysosome
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:mmu02010]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mmu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 A2-B; 2 17.25 cM
AA seq 2433 aa AA seqDB search
MGFLHQLQLLLWKNVTLKRRSPWVLAFEIFIPLVLFFILLGLRQKKPTISVKEAFYTAAP
LTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLHRVVEEGNLFDPVRPSLGSEL
EALRQRLEALSSGPGTWESHSARPAVSSFSLDSVARDQRELWRFLMQNLSLPNSTAQALL
AARVDPSEVYRLLFGPLPDLDGKLGFLRKQEPWSRLGSNPLLQMEELLLAPALLEQLTCA
PGSGELGRILTMPEGHQVDLQGYRDAVCSGQATARAQRFSDLAAELRNQLDTAKIAQQLG
FDVPNGSDPQPQAPSPQSLPALLGDLLDAQKLLQDVDVLSALALLLPQGACAGQASAPQA
SSLNGLANSTGIGANSGSNTTVEEGTQSPVSPASPDTLQGQCSAFVQLWAGLQPILCGNN
RTIEPEALRRGNMSSLGFTSKEQRNLGLLVHLMTSNPKILYAPVGSEADRVILKANETFA
FVGNVTHYAQVWLNISTEIRSFLEQGRLQQHLQWLQQYVADLQLHPEAMNLSLEELPPAL
RQDFSLPNGTALLQQLDTIDNAACGWIQFMSKVSVDIFKGFPDEESIVNYTLNQAYQDNV
TVFASVIFQTRKDGSLPPHVHYKIRQNSSFTEKTNEIRRAYWRPGPNTGGRFYFLYGFVW
IQDMMERAIINTFVGHDVVEPGNYVQMFPYPCYTRDDFLFVIEHMMPLCMVISWVYSVAM
TIQHIVAEKEHRLKEVMKTMGLNNAVHWVAWFITGFVQLSISVTALTAILKYGQVLMHSH
VLIIWLFLAVYAVATIMFCFLVSVLYSKAKLASACGGIIYFLSYVPYMYVAIREEVAHDK
ITAFEKCIASLMSTTAFGLGSKYFALYEVAGVGIQWHTFSQSPVEGDDFNLLLAVTMLMV
DTVVYGVLTWYIEAVHPGMYGLPRPWYFPLQKSYWLGSGRTEAWEWSWPWAHTPRLSVME
EDQACAMESRHFEETRGMEEEPTHLPLVVCVDKLTKVYKNDKKMALNKLSLNLYENQVVS
FLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTV
EEHLWFYSRLKSMAQEEIRKETDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGS
RAIILDEPTAGVDPYARRAIWDLILKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLKC
CGSPLFLKGAYGDGYRLTLVKQPAEPGTSQEPGLASSPSGCPRLSSCSEPQVSQFIRKHV
ASSLLVSDTSTELSYILPSEAVKKGAFERLFQQLEHSLDALHLSSFGLMDTTLEEVFLKV
SEEDQSLENSEADVKESRKDVLPGAEGLTAVGGQAGNLARCSELAQSQASLQSASSVGSA
RGEEGTGYSDGYGDYRPLFDNLQDPDNVSLQEAEMEALAQVGQGSRKLEGWWLKMRQFHG
LLVKRFHCARRNSKALCSQILLPAFFVCVAMTVALSVPEIGDLPPLVLSPSQYHNYTQPR
GNFIPYANEERQEYRLRLSPDASPQQLVSTFRLPSGVGATCVLKSPANGSLGPMLNLSSG
ESRLLAARFFDSMCLESFTQGLPLSNFVPPPPSPAPSDSPVSPDEDSLQAWNMSLPPTAG
PETWTSAPSLPRLVHEPVRCTCSAQGTGFSCPSSVGGHPPQMRVVTGDILTDITGHNVSE
YLLFTSDRFRLHRYGAITFGNVQKSIPASFGARVPPMVRKIAVRRVAQVLYNNKGYHSMP
TYLNSLNNAILRANLPKSKGNPAAYGITVTNHPMNKTSASLSLDYLLQGTDVVIAIFIIV
AMSFVPASFVVFLVAEKSTKAKHLQFVSGCNPVIYWLANYVWDMLNYLVPATCCVIILFV
FDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATV
ATFLLQLFEHDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMK
SPFEWDIVTRGLVAMTVEGFVGFFLTIMCQYNFLRQPQRLPVSTKPVEDDVDVASERQRV
LRGDADNDMVKIENLTKVYKSRKIGRILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKML
TGDESTTGGEAFVNGHSVLKDLLQVQQSLGYCPQFDALFDELTAREHLQLYTRLRGIPWK
DEAQVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKA
RRFLWNLILDLIKTGRSVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGY
MITVRTKSSQNVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVVGV
LGIEDYSVSQTTLDNVFVNFAKKQSDNVEQQEAEPSSLPSPLGLLSLLRPRPAPTELRAL
VADEPEDLDTEDEGLISFEEERAQLSFNTDTLC
NT seq 7302 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcctgcaccagctgcagctgctgctctggaagaacgtgacgctgaagcgccgg
agcccgtgggtcctggcttttgagatcttcatcccgcttgtcctcttcttcatcctgttg
ggactgcggcagaagaagcccaccatctctgtgaaggaagctttctacaccgcagcaccg
ctgacatcagccggcatcctgcccgtcatgcagtcgctttgccctgatggccagcgtgat
gagtttggcttcctgcaatatgccaactccacggtcacccagcttctggaacgcctccac
cgtgtagtggaggagggcaatttgttcgacccagtgcgacccagcctgggctcagagctc
gaggctctgcgccaacgtctggaggccctcagctcaggccctggcacctgggagagtcac
tcagccagacctgcagtttcatccttctctctggactcggtggccagggaccagagagag
ctttggcgtttcctgatgcagaacctgtcactgcccaacagcacggcccaagccctccta
gctgcccgtgtggacccttccgaggtctatcgcttgctttttggtcctttgcctgacctg
gatggaaagttgggtttccttaggaagcaggagccctggagccgcctgggtagcaatcct
ctgctccaaatggaggagctgctgctggctcctgcccttttggaacagctcacatgtgct
ccaggttctggggaactgggccggattcttaccatgcctgagggtcatcaggtagacctt
cagggctaccgggatgctgtgtgcagtgggcaggctacagctcgtgcccagcgcttcagc
gatttggccgctgagctcaggaaccagctggacacagccaagattgctcagcagctgggc
ttcgatgtccccaacggctcagatccccagccacaggcaccgtccccacagagcctgccg
gcactcttaggggacctgctggatgcccagaaacttctgcaggatgtggatgtcctatca
gcccttgccctgctgctgcctcaaggtgcctgtgctggccaggcctctgcacctcaagcc
agcagcctgaatggcctggccaacagcaccgggataggtgcaaattcaggttccaacacc
actgttgaggagggcacccagtcacctgtcagcccagcctctcctgacactctgcaaggg
cagtgctcagcctttgtgcagctctgggctggcttgcaacccatcttgtgtggcaacaac
cgcaccatcgagcctgaagcgcttcggagaggcaacatgagctccctgggttttacaagc
aaggaacagcggaacttgggccttctagtgcacctcatgaccagcaaccccaaaatcctg
tacgcaccagtgggctctgaagcggaccgcgttatcctcaaggcaaatgagacctttgcc
tttgtgggcaacgttacacactacgcccaggtctggctcaacatctccacagagatccga
agcttcttggagcaaggcaggctgcagcagcatctgcagtggttacagcagtatgtagct
gatcttcagctacaccctgaagcaatgaacctgtccctggaggagctgccacctgctctg
cgccaggacttctcactgcctaatggcacagccctcctgcaacagcttgacacaatagac
aacgcagcctgtggctggatccagttcatgtccaaggtgagtgtggacatcttcaaggga
tttcctgatgaggagagcatcgtgaactacactctcaatcaggcctaccaggacaatgtc
acagtgtttgccagcgtgatcttccagacacggaaggacggctccctccctccacatgta
cattacaagattcgccagaattcaagcttcactgagaaaaccaatgagatccgccgtgct
tattggcgtccagggcccaacaccggtggtcgcttctacttcctctatggcttcgtctgg
atccaggacatgatggagcgcgccatcatcaacacatttgtggggcatgacgtggtcgaa
cctggcaactacgtgcagatgttcccatacccctgctacacccgtgacgacttcctgttt
gtcattgaacacatgatgccattgtgcatggtgatctcctgggtctactctgtggccatg
accatccagcatattgtggcagagaaagagcacaggctcaaggaggtgatgaagacgatg
ggcctgaacaacgccgtgcactgggtggcctggttcatcacgggctttgtgcagctgtct
atctccgtgacagctctgaccgccatcctcaagtacggccaggtgctcatgcacagccac
gtgctcattatctggctcttccttgccgtctacgctgtggccactatcatgttttgcttc
ctggtgtctgtgctgtactctaaggctaagttggcctcagcctgtggcggtatcatctac
ttcctgagctacgttccctacatgtatgtagcgatccgcgaggaggtagcccatgacaag
atcactgccttcgagaagtgcattgcgtccctgatgtccacaacagcctttggcctgggt
tccaagtactttgcactgtatgaagtggcaggagtgggcatccagtggcacacgttcagc
cagtccccagtggaaggagatgacttcaatctgctccttgctgtcaccatgcttatggtg
gacacggtggtctacggcgtgctcacttggtacattgaggctgtgcacccaggtatgtat
gggctgccccggccctggtacttcccgctacagaagtcctattggctgggcagtgggcgg
acagaagcctgggagtggagctggccatgggcacacacaccgcgcctcagcgttatggag
gaggaccaggcctgtgccatggagagccggcacttcgaggagacccgcggcatggaggag
gagcccacccacctgcccttggtcgtctgtgtggacaagctcaccaaggtctataagaat
gacaagaagatggccttaaacaaactgagcctcaatctgtatgagaatcaggtggtctct
ttcctaggccacaacggggccggcaagaccacgaccatgtcgatcctgactggactgttc
ccacccacgtcgggctcagccactatctatgggcacgacatccgcaccgagatggatgag
atccgcaagaacctgggcatgtgcccacagcacaacgtgctctttgaccggctcacggtg
gaggagcacctctggttctactcacgcctcaaaagcatggcacaggaggagatccgcaaa
gagacggacaagatgattgaggacctggaactctctaacaagcggcactcactggtgcag
acgttgtctggaggcatgaagcgcaagctttcggtagccattgcctttgtgggtggctct
agagccattatcttagacgagcccacggctggcgtggacccctatgctcgccgtgccatc
tgggacctcattctgaagtacaagccgggccgcactatcctcctgtctacccatcacatg
gatgaggctgacctgctgggggatcgcattgccatcatctcccatgggaagctcaaatgc
tgtggctctcccctcttcctcaagggagcctatggcgatgggtaccgcctcacattggtc
aagcagcctgcagaacctggcacctcccaagagccagggctggcttccagcccctcaggt
tgtcctcggctgagcagctgctcggagccgcaagtgtcccagttcatccgcaagcatgtg
gcttcctccctgctggtctcagacacgagcaccgagctctcctacatcctgcccagcgag
gccgtcaagaagggggccttcgagcgcctctttcagcaactggaacacagcctggatgcg
ctccatctgagcagttttgggctgatggacacaactctggaggaggtgttcctcaaggtg
tctgaagaagatcagtcactggagaacagcgaggctgatgtgaaggagtcccggaaggat
gtgctgcctggggcagagggcctgacagctgtggggggtcaagctggcaacctggctcgg
tgctcagagctggcacagtcacaggcatcgctgcagtctgcatcctctgtgggctctgcc
cgtggggaggagggcaccggctactctgatggctacggtgactaccgtcccctctttgac
aacttgcaggacccagacaatgtcagcttacaagaggcagagatggaggccctggctcag
gtgggccagggcagccgcaaactcgagggctggtggctgaagatgcggcagttccatggg
ctcctggtgaagcgcttccactgtgctcgtcggaactccaaagctctctgctctcagatt
ctgctgcctgccttctttgtctgtgtggccatgactgtggcgttgtctgtccctgagatt
ggtgacctacctccactggtcctgtcaccctctcagtaccacaactacacccagccccgt
ggcaactttatcccttatgccaatgaggaacgccaggagtaccgattacggctgtcacct
gatgccagcccccagcagctggtgagcacattccggctgccctctggtgtgggtgccact
tgtgtgctcaagtctcctgccaacggctccctgggacccatgctgaacttaagcagtgga
gagtcccgcctgctggcggcacggttcttcgacagtatgtgcctggagtccttcacacag
gggctgccactgtccaacttcgtgccacctccgccctcacccgccccttctgactcaccc
gtgtccccagatgaggattcactgcaagcctggaacatgtccctgccacctactgctggg
ccagagacgtggacgtcggcgccttctctgccacgcctagtgcatgagccagtccgctgt
acctgctctgcacagggcacggggttctcatgccccagcagtgtgggtggacacccaccc
cagatgagagtggtcacaggtgacatcctgactgacatcactggccacaatgtttctgag
tacctgctcttcacctctgaccgtttccgactacaccgatatggagccatcacctttggt
aatgttcagaagtctatcccagcatcctttggtgcccgggtccctcctatggtgcggaag
attgcagtgcggagggtggctcaggtgctctacaataacaagggctaccacagcatgccc
acctacctcaacagcctcaacaatgccattctgcgtgcaaacctacccaaaagcaagggc
aatccagcagcctatggcatcaccgtcaccaaccaccccatgaacaagaccagtgctagc
ctctccctggattacctactgcagggcacagatgtggtcatcgccatcttcatcattgtg
gccatgtccttcgtgccagccagctttgtggtcttccttgtggcagagaaatccaccaag
gccaaacacctgcagttcgtcagcgggtgcaaccctgtcatctactggctggccaactac
gtgtgggacatgctcaattacctggtcccagccacctgctgcgtgatcatcctctttgtc
tttgacttacctgcctacacatcacccaccaacttccccgcggtgctctccttgttcctg
ctctatgggtggtccatcacacccatcatgtacccagcctccttctggtttgaggtccct
agctcagcctacgtgttcctcatcgtcatcaacctcttcatcggcatcacagccacggtg
gccactttccttctgcagctttttgagcatgacaaggatctgaaggttgtcaacagttac
ctgaaaagctgcttcctcatcttccccaactacaacctgggccacgggctcatggagatg
gcctacaatgagtacatcaacgaatactacgccaagattggccagtttgacaagatgaag
tccccgttcgagtgggacattgtcacacgtggactggtggccatgacagtcgagggcttc
gtgggattcttcctcaccatcatgtgccagtataacttcctacggcagccacaacgcctg
cctgtgtctactaaacctgtggaagacgatgtggatgtggctagtgagcgacagagagtg
ctccgtggcgatgctgacaatgacatggtcaagattgagaacctgaccaaggtgtacaag
tctcggaagattggccggatcctggcagtggaccgcctttgcctgggtgtgcgccctgga
gagtgctttgggctccttggtgtcaatggtgcagggaagaccagcaccttcaagatgctg
actggagatgagagcacaactgggggagaggcctttgtcaatggacacagcgtgctcaag
gacctgctccaggtacagcagagccttggctactgcccgcagtttgatgccctgtttgat
gagctcacggctcgtgaacacctgcagctgtacacgcggctgcgtggcatcccctggaag
gatgaggcacaggtagtgaagtgggccctagagaagctggaactgacaaagtatgcagac
aagccagctggcacctacagtggaggcaacaaacggaagctttccacagccattgccctc
attgggtaccctgccttcatctttctagatgagcccaccactggcatggaccctaaggcc
cggcgcttcctgtggaacctcattctggacctcatcaagacgggacgttcggtggtgctg
acgtcacacagcatggaggagtgtgaggctctgtgcacacgcttggccatcatggtgaac
gggcggctgcgctgcctgggcagcatccagcaccttaagaacaggtttggggatggctac
atgattactgtaaggaccaaaagcagccagaacgtgaaggacgtggtgcggttcttcaac
aggaacttcccagaggccatgctcaaggaaagacaccatacgaaggtgcagtatcagctc
aagtcagagcacatctcgctggctcaggtgttcagcaagatggagcaggtggtgggtgtg
ctgggcatcgaggattactcagtcagccagaccaccctggataacgtgtttgtgaacttt
gcgaagaagcagagtgataatgtggagcagcaagaggctgagccctcgtccttgccgtcc
ccccttggactgctcagcctgctgaggccccgccccgcacccacagagctccgggcattg
gtggctgatgagccagaggacctggacacagaggatgaaggcctcatcagcttcgaggaa
gagcgggcccagctctccttcaacactgatacgctctgctga

DBGET integrated database retrieval system