KEGG   Mus musculus (mouse): 11423Help
Entry
11423             CDS       T01002                                 

Gene name
Ache
Definition
acetylcholinesterase (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    11423 (Ache)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    11423 (Ache)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     11423 (Ache)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 G2; 5 76.32 cM
AA seq 614 aa AA seqDB search
MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPV
SAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSM
NYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTEL
IACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVG
VVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPE
DPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQ
YVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQERCSDL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctccctggtatcccctgcatacaccttccctggcttttccactcctcttcctc
ctcctctccctcctgggaggaggggcaagggctgagggccgggaagacccgcagctgctg
gtgagggttcgagggggccagctgaggggcatccgcctgaaggcccctggaggcccagtc
tcagcttttctgggcatcccctttgcagagccacctgtgggctcacgtagatttatgcca
ccagagcccaagcggccctggtcaggagtgttggatgctaccaccttccaaaatgtctgc
taccagtacgtggacaccctgtaccctgggtttgagggtactgagatgtggaaccccaac
cgagagttgagtgaagactgcctgtatcttaatgtgtggacaccataccccagacctgct
tctcccacacctgtcctcatctggatctatgggggtggtttctacagcggagcggcctcc
ttggatgtgtatgacggccgtttcctggcccaggttgagggagctgtgttggtatctatg
aactaccgagtgggaacctttggcttcttggccctaccaggaagcagagaagcccctggc
aatgtaggtctgctggatcaacggcttgccttgcaatgggtgcaagaaaatattgcagcc
tttgggggcgacccgatgtcagtgactctgtttggggagagtgcgggtgcagcctccgtg
ggcatgcacatactgtccctgcccagcaggagcctcttccacagggctgtcctccagagt
ggcacacccaatgggccctgggccactgtgagtgctggagaggccaggcgcagggccaca
ctgctggcccgccttgtgggctgtcccccaggtggcgctggtggcaatgacaccgagctg
atagcctgcttgaggacaaggcccgctcaggacctggtggaccacgagtggcacgtcctg
cctcaagaaagtatcttccgattttccttcgtgcctgtggtagacggggacttcctcagt
gacacaccggaggctctcatcaatactggagattttcaagacctgcaggtgctggtgggt
gtggtgaaggacgagggctcctactttctggtttacggggtcccaggcttcagcaaagac
aatgaatctctcatcagccgggcccagttcctggctggggtgcggatcggtgtaccccaa
gcaagtgacctggcagccgaggctgtggtcctgcattacacagactggctgcaccctgag
gaccctactcacctgagagatgccatgagtgcagtggtaggcgaccacaacgttgtgtgc
cctgtggcccagctggctgggcgactggctgcccaaggggcccgggtctatgcctacatc
tttgaacaccgtgcctccacactgacttggcccctctggatgggggtgccccatggctat
gaaatcgagttcatctttgggctccccctggatccctcgctgaactacaccacggaggag
aggatctttgctcagcgacttatgaaatactggaccaattttgcccgcacaggggacccc
aatgaccctcgagactccaaatctccacagtggccaccgtacaccactgccgcgcagcaa
tatgtgagcctgaacctgaagcccttagaggtgcggcggggactgcgcgcccagacctgc
gccttctggaatcgctttctccccaaattgctcagcgccaccgatactctggacgaggcg
gagcgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagttcgaccactatagcaagcaggagcgctgctcagacctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system