KEGG   Mus musculus (mouse): 11423Help
Entry
11423             CDS       T01002                                 

Gene name
Ache, mE1a, mE1b, mE1c, mE1c-long, mE1d, mE1d', mE1e
Definition
acetylcholinesterase (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mmu00564]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:mmu04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 G2; 5 76.32 cM
AA seq 614 aa AA seqDB search
MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPV
SAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSM
NYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTEL
IACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVG
VVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPE
DPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQ
YVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQERCSDL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctccctggtatcccctgcatacaccttccctggcttttccactcctcttcctc
ctcctctccctcctgggaggaggggcaagggctgagggccgggaagacccgcagctgctg
gtgagggttcgagggggccagctgaggggcatccgcctgaaggcccctggaggcccagtc
tcagcttttctgggcatcccctttgcagagccacctgtgggctcacgtagatttatgcca
ccagagcccaagcggccctggtcaggagtgttggatgctaccaccttccaaaatgtctgc
taccagtacgtggacaccctgtaccctgggtttgagggtactgagatgtggaaccccaac
cgagagttgagtgaagactgcctgtatcttaatgtgtggacaccataccccagacctgct
tctcccacacctgtcctcatctggatctatgggggtggtttctacagcggagcggcctcc
ttggatgtgtatgacggccgtttcctggcccaggttgagggagctgtgttggtatctatg
aactaccgagtgggaacctttggcttcttggccctaccaggaagcagagaagcccctggc
aatgtaggtctgctggatcaacggcttgccttgcaatgggtgcaagaaaatattgcagcc
tttgggggcgacccgatgtcagtgactctgtttggggagagtgcgggtgcagcctccgtg
ggcatgcacatactgtccctgcccagcaggagcctcttccacagggctgtcctccagagt
ggcacacccaatgggccctgggccactgtgagtgctggagaggccaggcgcagggccaca
ctgctggcccgccttgtgggctgtcccccaggtggcgctggtggcaatgacaccgagctg
atagcctgcttgaggacaaggcccgctcaggacctggtggaccacgagtggcacgtcctg
cctcaagaaagtatcttccgattttccttcgtgcctgtggtagacggggacttcctcagt
gacacaccggaggctctcatcaatactggagattttcaagacctgcaggtgctggtgggt
gtggtgaaggacgagggctcctactttctggtttacggggtcccaggcttcagcaaagac
aatgaatctctcatcagccgggcccagttcctggctggggtgcggatcggtgtaccccaa
gcaagtgacctggcagccgaggctgtggtcctgcattacacagactggctgcaccctgag
gaccctactcacctgagagatgccatgagtgcagtggtaggcgaccacaacgttgtgtgc
cctgtggcccagctggctgggcgactggctgcccaaggggcccgggtctatgcctacatc
tttgaacaccgtgcctccacactgacttggcccctctggatgggggtgccccatggctat
gaaatcgagttcatctttgggctccccctggatccctcgctgaactacaccacggaggag
aggatctttgctcagcgacttatgaaatactggaccaattttgcccgcacaggggacccc
aatgaccctcgagactccaaatctccacagtggccaccgtacaccactgccgcgcagcaa
tatgtgagcctgaacctgaagcccttagaggtgcggcggggactgcgcgcccagacctgc
gccttctggaatcgctttctccccaaattgctcagcgccaccgatactctggacgaggcg
gagcgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagttcgaccactatagcaagcaggagcgctgctcagacctgtga

DBGET integrated database retrieval system