KEGG   Mus musculus (mouse): 11429Help
Entry
11429             CDS       T01002                                 

Gene name
Aco2, Aco-2, Aco3, D10Wsu183e
Definition
(RefSeq) aconitase 2, mitochondrial (EC:4.2.1.3)
  KO
K01681  
aconitate hydratase [EC:4.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    11429 (Aco2)
   01210 2-Oxocarboxylic acid metabolism
    11429 (Aco2)
   01230 Biosynthesis of amino acids
    11429 (Aco2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    11429 (Aco2)
   00630 Glyoxylate and dicarboxylate metabolism
    11429 (Aco2)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     11429 (Aco2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15; 15 E1
AA seq 780 aa AA seqDB search
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPSEYIRYDLLEKNINIVRKRLN
RPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAV
PSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGRTDIANLAEEFKDHLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHP
VADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS
EQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRSDFDPG
QDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAA
GPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVI
GDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHP
VDKLTIQGLKDFAPGKPLKCVIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQ
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttacagcctcctggtcacccggctgcagaaggccctgggtgtgcggcagtac
catgtggcctctgtcctgtgccaacgggccaaggtggccatgagccattttgagcccagt
gagtacatccgatatgacctgctagagaagaacattaacattgtccgtaaacggttgaac
cggcctcttactctctcagagaagattgtatatggacacctggatgacccagccaaccag
gagatcgagcggggaaagacatacctgcgtttacggcccgaccgggtggccatgcaggat
gccacagcccagatggctatgctacagttcattagcagtgggctgcctaaggtggctgta
ccatcaaccatccactgtgatcatctgattgaggcccaggttgggggtgagaaagacctg
cgcagggccaaggacataaaccaggaagtgtataatttcctggcaactgcaggtgccaag
tatggtgtgggcttctggaggcctggatctgggatcattcaccagatcattctagaaaac
tatgcataccctggagttcttctgatcggcactgattcgcacacccccaatggtggtggc
ctgggaggcatctgcattggagtagggggtgctgatgctgtggatgtcatggctgggatc
ccctgggagctgaagtgtcccaaggtgatcggtgtgaagctgacaggctccctctctggt
tggacctcacccaaagatgtgatcctgaaagtggcaggtatcctcacggtgaaaggtggc
acaggtgctattgtggaataccacggacccggtgtcgattccatctcctgcactggcatg
gcaactatctgcaacatgggtgcagaaattggggccactacgtcagtgttcccatacaac
cacaggatgaaaaagtacctgagcaagacaggccgaacagacattgccaacctagcagaa
gaattcaaggatcacttagtgcctgatcctggctgccagtatgaccaagtgattgaaatt
aacctcaatgagctaaagccacatatcaatgggccctttacccctgacttggctcaccca
gtggcagatgtggggactgtggcagagaaggaaggctggcctctggacatcagagtaggt
ttgattggcagctgcaccaattcaagctatgaggacatgggacgatcagcagctgtggct
aagcaggcattggcccacggactcaagtgcaagtcccagttcaccatcaccccaggctct
gagcagatccgtgccactattgagcgggatggctatgcacagatcttaagggatgtgggt
ggaatcgttttggccaatgcctgtggcccttgcatcggccagtgggacagaaaagacatc
aagaagggggagaagaatacaatcgtcacctcttacaacaggaacttcacaggccgtaat
gatgcaaaccctgagacccatgcctttgtcacatccccagagattgtcacagctctggcc
attgcaggaaccctgaagttcaatccagaaactgacttcttaacaggcaaggacggcaag
aagttcaagttggaggctccagatgcagacgagcttccccgatcggactttgatccaggg
caggacacataccagcacccccctaaggacagcagtgggcagcgggtggacgtgagccct
accagccagcgcctgcagctcctggagcctttcgacaagtgggacggcaaagacctcgag
gacctgcaaatcctcatcaaggtcaaagggaagtgcaccacagaccacatttctgctgcc
ggcccctggctcaagttccgtgggcatctggataacatctctaacaacctgctcatcggt
gccatcaacatcgaaaatggcaaagccaactctgtacgcaatgctgtcacccaggagttt
ggccctgtacctgacactgctcgctactacaagaaacatggcatcaggtgggtggtgatt
ggagatgagaactatggtgagggctcaagccgggagcatgcagcactggagcctcgccac
cttgggggccgggccatcatcaccaagagcttcgccaggatccacgaaaccaatctaaag
aagcagggcttgctgcccctcaccttcgctgacccctccgactataacaagattcatcca
gtggacaagctgaccattcaaggcctgaaggactttgcccctggaaagcctctgaagtgc
gtcatcaagcaccccaatgggacccaggagaccatcctcctgaaccacaccttcaacgag
acccagatcgagtggttccgtgcaggcagtgccctcaacaggatgaaggagctgcagcag
tga

DBGET integrated database retrieval system