KEGG   Mus musculus (mouse): 11434Help
Entry
11434             CDS       T01002                                 

Gene name
Acr
Definition
acrosin prepropeptide (EC:3.4.21.10)
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     11434 (Acr)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   11434 (Acr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 E-F; 15 44.96 cM
AA seq 267 aa AA seqDB search
MVEMLPTVAVLVLAVSVVAKDNTTCDGPCGLRFRQNSQAGTRIVSGQSAQLGAWPWMVSL
QIFTSHNSRRYHACGGSLLNSHWVLTAAHCFDNKKKVYDWRLVFGAQEIEYGRNKPVKEP
QQERYVQKIVIHEKYNVVTEGNDIALLKITPPVTCGNFIGPCCLPHFKAGPPQIPHTCYV
TGWGYIKEKAPRPSPVLMEARVDLIDLDLCNSTQWYNGRVTSTNVCAGYPEGKIDTCQWW
ASHVQRQRRQPLCGRGDHELGGRLCPC
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtagagatgctgccaactgtcgctgtgctggtcttggcagtgtccgtggttgccaag
gataacaccacgtgtgatggtccctgtgggttacgattcaggcagaactcacaagcaggt
acccggattgtcagtgggcagagtgcgcagcttggggcctggccctggatggtcagctta
cagatcttcacgtcccataacagccgcaggtaccacgcctgtggaggcagcctcctgaac
tcccactgggtgctcacagctgcccactgcttcgataacaaaaaaaaagtctatgactgg
agactggttttcggagcacaagaaatcgaatatggaagaaacaagccagtgaaagagccc
cagcaggagagatatgtgcagaagattgtcatccatgagaaatacaacgtagtgacggag
ggaaatgacattgcgctcttgaagatcactcctcctgttacatgtgggaacttcattgga
ccctgctgtctacctcattttaaggcgggtcctccccaaataccccacacctgctacgtg
actgggtggggatacataaaagagaaggcccccaggccatcacctgtcctgatggaagca
cgtgtggacctcattgacctcgacctgtgtaactcaacccagtggtacaatgggcgtgtc
acatcgactaatgtgtgtgcagggtatcctgaaggcaagattgacacctgccagtggtgg
gcctctcatgtgcagagacaacgtcgacagcccctttgtggtcgtggggatcacgagctg
gggggtaggctgtgcccgtgctaa

DBGET integrated database retrieval system