KEGG   Mus musculus (mouse): 11465Help
Entry
11465             CDS       T01002                                 

Gene name
Actg1, AL023024, Actg, Actl, E51
Definition
(RefSeq) actin, gamma, cytoplasmic 1
  KO
K05692  
actin beta/gamma 1
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Phagosome
Apoptosis
Hippo signaling pathway
Focal adhesion
Adherens junction
Tight junction
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Bacterial invasion of epithelial cells
Salmonella infection
Influenza A
Proteoglycans in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    11465 (Actg1)
   04390 Hippo signaling pathway
    11465 (Actg1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    11465 (Actg1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    11465 (Actg1)
  Cell growth and death
   04210 Apoptosis
    11465 (Actg1)
  Cellular commiunity
   04510 Focal adhesion
    11465 (Actg1)
   04520 Adherens junction
    11465 (Actg1)
   04530 Tight junction
    11465 (Actg1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    11465 (Actg1)
   04670 Leukocyte transendothelial migration
    11465 (Actg1)
  Endocrine system
   04921 Oxytocin signaling pathway
    11465 (Actg1)
   04919 Thyroid hormone signaling pathway
    11465 (Actg1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    11465 (Actg1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    11465 (Actg1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    11465 (Actg1)
   05414 Dilated cardiomyopathy (DCM)
    11465 (Actg1)
   05416 Viral myocarditis
    11465 (Actg1)
  Infectious diseases
   05132 Salmonella infection
    11465 (Actg1)
   05100 Bacterial invasion of epithelial cells
    11465 (Actg1)
   05164 Influenza A
    11465 (Actg1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     11465 (Actg1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     11465 (Actg1)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     11465 (Actg1)
    NuA4 complex
     11465 (Actg1)
  Chromatin remodeling factors
   BAF complex
    11465 (Actg1)
   PBAF complex
    11465 (Actg1)
   SWR1 complex
    11465 (Actg1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    11465 (Actg1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     11465 (Actg1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   11465 (Actg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 E2
AA seq 375 aa AA seqDB search
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaatcgccgcactcgtcattgacaatggctccggcatgtgcaaagccggc
tttgctggcgacgacgcccccagggccgtgttcccttccatcgtagggcgcccccgacac
cagggcgtcatggtgggcatgggccagaaagactcatacgtgggtgacgaggcccagagc
aagaggggtatcctgaccctgaagtaccctatcgaacacggcattgtcactaactgggac
gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggctcctgaggag
cacccggtgcttctgaccgaggcccccctgaaccccaaagctaacagagagaagatgacg
cagataatgtttgaaaccttcaataccccagccatgtacgtggccattcaggcggtgctg
tccttgtatgcatctgggcgcaccactggcattgtcatggactctggtgacggggtcaca
cacacagtgcccatctatgagggctacgcccttccccacgccatcttgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctgactgaacggggctacagcttt
accaccactgctgagagggaaattgttcgtgacataaaggagaagctgtgctatgttgcc
ctggattttgagcaagaaatggctactgctgcatcatcttcctccttggagaagagttac
gagctgcccgacgggcaggtgatcaccattggcaatgagcggttccggtgtccggaggca
ctcttccagccttccttcctgggcatggagtcctgtggtatccatgagaccactttcaac
tccatcatgaagtgtgatgtggatatccgcaaagacctgtatgccaatacagtgctgtct
ggtggtaccaccatgtacccaggcattgctgacaggatgcagaaggagatcacagcccta
gcacctagcacgatgaagattaagatcattgctccccctgagcgcaagtactcagtctgg
atcggtggctccattctggcctcactgtccaccttccagcagatgtggatcagcaagcag
gagtatgatgagtcaggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system