KEGG   Mus musculus (mouse): 114716Help
Entry
114716            CDS       T01002                                 

Gene name
Spred2, C79158
Definition
sprouty-related, EVH1 domain containing 2
Orthology
K04703  
sprouty-related, EVH1 domain-containing protein
Organism
mmu  Mus musculus (mouse)
Pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:mmu04630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 A3.2
AA seq 410 aa AA seqDB search
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIE
DLIEGSTTSSSTLHNEAELGDDDVFTTATDSSSNSSQKREPTTRTISSPTSCEHRKIYTL
DPYPMDHYHPDQRLPRSYPQVTFPEDDEEIVRINPREKIWMTGYEDYRHAPVRGKYLDTT
EDADSYVRFAKGEVPKHEYTYPYVDSSDFGFGEDPKGSVIKTQPPRAKSRRRKENGERSR
CVYCRDMFNHEENRRGHCQDAPDAVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCSCD
TSDEKFCLRWMALIALSFLAPCMCCYLPLRACHRCGVMCRCCGGKHKAAA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaaacacacccggacgatgacagctatattgtgcgtgtcaaggctgtggtt
atgaccagagatgactccagcgggggatggttcccacaggaaggaggcgggatcagtcgc
gtcggcgtgtgtaaggtcatgcaccctgaaggcaacggacgaagcggctttctcatccat
ggcgagcgacagaaagacaaactggtggtattggaatgctatgtcagaaaggacttggtc
tacaccaaagccaatccgacgtttcatcattggaaggttgataacaggaagtttggactt
actttccaaagtcctgcagatgcacgagcctttgacaggggcgtgagaaaagccattgaa
gaccttatagaaggttcaacgacctcctcttccactctccataacgaagctgagctcgga
gacgatgacgttttcacgacagctacggacagttcttctaattcctcgcagaagagggag
ccgactacgaggacaatctcctcccccacgtcctgtgagcaccggaagatttataccctt
gacccataccccatggaccattaccaccctgaccagcggttgccgcggtcctacccccag
gtcaccttcccagaagatgatgaagaaattgtacgcatcaacccccgagagaagatctgg
atgaccggttatgaagactaccggcacgcgccggttcgcggcaaatacttagacaccaca
gaagacgcggactcctacgtgcgcttcgccaagggcgaagtccccaaacacgaatatacc
tatccctatgttgattcttcggacttcggcttcggggaggatcccaaaggtagtgtgatc
aagacacagccgcccagggccaagtcccgtcggcggaaggagaacggcgaacggtcgcgg
tgtgtgtactgcagggatatgtttaatcacgaagagaaccgaaggggccactgccaagac
gcgcccgacgccgtgagaacttgcattcgccgggtgagctgtatgtggtgcgcggacagc
atgctgtaccactgtatgtccgaccccgagggagactacactgacccttgttcgtgtgac
acaagcgatgagaagttttgcctccggtggatggctctaattgccttgtctttcctggcc
ccttgtatgtgctgttacctgcccctccgggcctgccaccgctgtggagtgatgtgcagg
tgctgtggtgggaagcacaaagccgccgcgtga

DBGET integrated database retrieval system