KEGG   Mus musculus (mouse): 11475Help
Entry
11475             CDS       T01002                                 

Gene name
Acta2, 0610041G09Rik, Actvs, SMalphaA, a-SMA, alphaSMA
Definition
(RefSeq) actin, alpha 2, smooth muscle, aorta
  KO
K12313  
actin, aortic smooth muscle
Organism
mmu  Mus musculus (mouse)
Pathway
Vascular smooth muscle contraction
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    11475 (Acta2)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    11475 (Acta2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     11475 (Acta2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   11475 (Acta2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 C1
AA seq 377 aa AA seqDB search
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagaggaagacagcacagccctggtgtgcgacaatggctctgggctctgtaag
gccggcttcgctggtgatgatgctcccagggctgttttcccatccatcgtgggacgtccc
agacatcagggagtaatggttggaatgggccaaaaagacagctatgtgggggatgaagcc
cagagcaagagagggatcctgacgctgaagtatccgatagaacacggcatcatcaccaac
tgggacgacatggaaaagatctggcaccactctttctataacgagcttcgtgtggcccct
gaagagcatccgacactgctgacagaggcaccactgaaccctaaggccaaccgggagaaa
atgacccagattatgtttgagaccttcaatgtccccgccatgtatgtggctattcaggct
gtgctgtccctctatgcctctggacgtacaactggtattgtgctggactctggagatggt
gtgactcacaacgtgcctatctatgagggctatgccctgcctcatgccatcatgcgtctg
gacttggctggccgagatctcaccgactacctcatgaagatcctgactgagcgtggctat
tccttcgtgactactgccgagcgtgagattgtccgtgacatcaaggagaagctgtgctat
gtagctctggactttgaaaatgagatggccacggccgcctcctcttcctccctggagaag
agctacgaactgcctgacgggcaggtgatcaccattggaaacgaacgcttccgctgccca
gagactctcttccagccatctttcattgggatggagtcagcgggcatccacgaaaccacc
tataacagcatcatgaagtgtgatattgacatcaggaaggatctctatgctaacaacgtc
ctgtcagggggtaccaccatgtacccaggcattgctgacaggatgcagaaggagatcaca
gccctcgcacccagcaccatgaagatcaagatcattgcccctccagaacgcaagtactct
gtctggatcggtggctccatcctggcttcgctgtctaccttccagcagatgtggatcagc
aaacaggaatacgacgaagctgggccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system