KEGG   Mus musculus (mouse): 11475Help
Entry
11475             CDS       T01002                                 

Gene name
Acta2, 0610041G09Rik, Actvs, SMalphaA, a-SMA, alphaSMA
Definition
(RefSeq) actin, alpha 2, smooth muscle, aorta
  KO
K12313  
actin, aortic smooth muscle
Organism
mmu  Mus musculus (mouse)
Pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    11475 (Acta2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     11475 (Acta2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   11475 (Acta2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
19; 19 C3
AA seq 377 aa AA seqDB search
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagaggaagacagcacagccctggtgtgcgacaatggctctgggctctgtaag
gccggcttcgctggtgatgatgctcccagggctgttttcccatccatcgtgggacgtccc
agacatcagggagtaatggttggaatgggccaaaaagacagctatgtgggggatgaagcc
cagagcaagagagggatcctgacgctgaagtatccgatagaacacggcatcatcaccaac
tgggacgacatggaaaagatctggcaccactctttctataacgagcttcgtgtggcccct
gaagagcatccgacactgctgacagaggcaccactgaaccctaaggccaaccgggagaaa
atgacccagattatgtttgagaccttcaatgtccccgccatgtatgtggctattcaggct
gtgctgtccctctatgcctctggacgtacaactggtattgtgctggactctggagatggt
gtgactcacaacgtgcctatctatgagggctatgccctgcctcatgccatcatgcgtctg
gacttggctggccgagatctcaccgactacctcatgaagatcctgactgagcgtggctat
tccttcgtgactactgccgagcgtgagattgtccgtgacatcaaggagaagctgtgctat
gtagctctggactttgaaaatgagatggccacggccgcctcctcttcctccctggagaag
agctacgaactgcctgacgggcaggtgatcaccattggaaacgaacgcttccgctgccca
gagactctcttccagccatctttcattgggatggagtcagcgggcatccacgaaaccacc
tataacagcatcatgaagtgtgatattgacatcaggaaggatctctatgctaacaacgtc
ctgtcagggggtaccaccatgtacccaggcattgctgacaggatgcagaaggagatcaca
gccctcgcacccagcaccatgaagatcaagatcattgcccctccagaacgcaagtactct
gtctggatcggtggctccatcctggcttcgctgtctaccttccagcagatgtggatcagc
aaacaggaatacgacgaagctgggccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system