KEGG   Mus musculus (mouse): 11491Help
Entry
11491             CDS       T01002                                 

Gene name
Adam17, CD156b, Tace
Definition
(RefSeq) a disintegrin and metallopeptidase domain 17 (EC:3.4.24.86)
  KO
K06059  
disintegrin and metalloproteinase domain-containing protein 17 [EC:3.4.24.86]
Organism
mmu  Mus musculus (mouse)
Pathway
Notch signaling pathway
Alzheimer's disease
Module
Notch signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    11491 (Adam17)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    11491 (Adam17)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.86  ADAM 17 endopeptidase
     11491 (Adam17)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   11491 (Adam17)
Cell adhesion molecules and their ligands [BR:mmu04516]
 2. Integrin Family
  Beta1 integrins
   VLA-5
    ITGB1; integrin beta 1 [KO:K05719]
     11491 (Adam17)
Cellular antigens [BR:mmu04090]
 Proteins
  11491 (Adam17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12 A1.3; 12 8.3 cM
AA seq 827 aa AA seqDB search
MRRRLLILTTLVPFVLAPRPPEEAGSGSHPRLEKLDSLLSDYDILSLANIQQHSIRKRDL
QSATHLETLLTFSALKRHFKLYLTSSTERFSQNLRVVVVDGKEESEYSVKWQNFFSGHVV
GEPDSRVLAHIGDDDVTVRINTDGAEYNVEPLWRFVNDTKDKRMLVYKSEDIKDFSRLQS
PKVCGYLNADSEELLPKGLIDREPSEEFVRRVKRRAEPNPLKNTCKLLVVADHRFYKYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGVQIEQIRILKSPQEVKPGERHFNM
AKSFPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYNPTVKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKPGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGDAEDDTVCLDLGKCKAGKCIPFCKREQELESCACVDTDNSC
KVCCRNLSGPCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHHSNIEMLSSMD
SASVRIIKPFPAPQTPGRLQALQPAAMMPPVPAAPKLDHQRMDTIQEDPSTDSHADDDGF
EKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQSRVDSKETEC
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggcgtctcctcatcctgaccactttggtgcctttcgtcctggcaccccgacct
ccggaggaagcaggctctggctcccatccgcgacttgagaagcttgattctttgctctca
gactacgacatcctctccttagctaatattcagcagcactccataaggaaaagggatcta
cagtctgcgacacacttagaaacattactaactttttcagctttgaaaagacattttaaa
ttatacttgacatcaagtaccgaacgcttttcacaaaacttgagagtcgtggtggtggac
gggaaagaagaaagcgagtacagcgtgaagtggcagaacttcttcagtggtcacgtggtt
ggtgagcctgactctagggttctagcccacataggagatgatgatgttacagtgagaatc
aacacagatggggcagaatataacgtagagccactttggaggtttgtcaatgatactaaa
gataaacgaatgctggtgtataagtctgaagatatcaaggatttttcacgtttgcagtct
ccaaaagtatgtggttatttaaatgcagatagtgaagagctgcttccaaaagggctcata
gacagagagccatctgaagagtttgttcgtcgagtgaagagacgagctgaacctaacccc
ttgaagaatacttgtaaattactggtggtagcagatcatcgattttataaatacatgggc
cgtggagaagagagcaccactacaaattacttaatagagctaattgaccgagttgatgac
atataccggaacacgtcgtgggataatgcagggtttaaagggtatggagtgcagatagag
cagattcgaattctcaagtctccacaagaggtaaaacctggtgaaagacacttcaatatg
gcaaaaagtttcccaaacgaagagaaggatgcttgggatgtgaagatgctattagagcaa
tttagctttgatatagctgaagaagcatctaaagtctgcctggctcatcttttcacgtac
caggattttgatatgggaactcttggattagcttacgttggttctcccagagcaaacagt
catggaggggtttgtccaaaagcttattacaacccaactgtgaagaaaaacatctattta
aatagtggtctgactagtactaaaaattatggcaaaactattctcacaaaggaagctgac
ctggttacaactcatgaattgggacataattttggagcagaacatgaccctgatgggcta
gcagaatgtgccccaaatgaggaccaaggaggaaagtatgtcatgtatcccatagctgtg
agcggtgaccacgagaataataagatgttttcaaactgcagtaaacagtccatctacaag
accatagaaagtaaggctcaagagtgcttccaggagcgcagcaacaaggtgtgtggcaac
tccagggtggatgaaggagaggagtgtgacccgggtattatgtacctgaacaacgacacc
tgctgcaatagtgactgcacactgaagccgggtgtgcagtgcagtgataggaacagtcct
tgctgtaaaaactgtcagtttgagacggcgcagaagaagtgccaggaggctattaatgct
acatgcaaaggagtgtcttactgcacagggaatagcagtgagtgccccccacccggagat
gctgaagatgacactgtgtgcttggaccttggcaagtgcaaggctgggaaatgcatccct
ttctgcaagagggagcaggagctggagtcctgcgcatgcgttgacactgacaactcgtgc
aaggtgtgctgcaggaacctttctggcccgtgtgtgccgtacgtcgatgcagagcaaaag
aacttgtttttgaggaaagggaagccatgtacagtagggttttgcgacatgaatggcaaa
tgtgagaaacgagtacaggacgtaattgagcgattttgggatttcattgaccagctgagc
atcaacacttttgggaagtttctggcagataacatcgttgggtctgttctggttttctcc
ttgatattttggattcctttcagcattcttgtccactgtgtggataagaaactggacaag
cagtatgaatccctgtctctgtttcatcacagtaacattgagatgctgagcagcatggac
tcagcatctgttcgcatcatcaagccctttcctgcaccccagactccaggtcgtctgcag
gccctgcagccagctgccatgatgccgccagtacctgcagctccaaaactggaccaccag
aggatggacaccatccaggaagaccccagcacagactcacatgcagatgatgacggtttt
gagaaggaccccttccccaacagcagcacagctgccaagtcctttgaggatctcacagac
cacccagtcaccaggagcgaaaaggcggcctcattcaagctgcagcgtcagagccgagtt
gacagcaaagagacagagtgctag

DBGET integrated database retrieval system