KEGG   Mus musculus (mouse): 11500Help
Entry
11500             CDS       T01002                                 

Gene name
Adam7, ADAM_7, EAP1, EAPI
Definition
(RefSeq) a disintegrin and metallopeptidase domain 7
  KO
K16071  
disintegrin and metalloproteinase domain-containing protein 7 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     11500 (Adam7)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   11500 (Adam7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14; 14 D2
AA seq 789 aa AA seqDB search
MLTTGIFWMTVLISHIQERGIVGVEGQELVHPKKLPLLHKRDLERIHDSDIPEEYEEELL
YEIKLGKKTLILHLLKAREFLSSNYSETYYNVKREVFTKHPQILDHCFYQGSIIHEFDSA
ASISTCNGLRGFFRVNDQRYLIEPVKYSDDGEHLVYKYNVKAPYATNHSCVGLNFTKKSA
LIDVENIEEHNAEDHHKEKFIELFVVADEYVYRRNNKPQNKLRKRIWGMVNFVNMIYKTL
NIHVTLAGFEIWSAGDKIEIVSNLESTLLHFSTWQETVLKKRKDFDHVILLSGKWLYTSM
QGIAYPGGICQILRSCSVVKDLLPDVNIIGNRMAHQLGHSLGMQHDGFPCTCPLGKCVMG
DGSIPAIKFSKCSQTQYQQFLQDQKPACILNNPFPEEFNDYPFCGNKKVDEGEECDCGPV
QECTNPCCDAHKCVLKPGFTCVEGECCESCQMKKEGAVCRLAKNECDISEVCTGYSPECP
KDEFQANGFPCRNGEGYCFMGLCPTRNEQCSELFIGGAEESHSLCYRMNKKGNRFGYCKN
KGNTFVPCEEKDLKCGKIYCSGGRPSSRLGEDKAYNLKNVKQNVTIKCRTMFLHHNSRDM
GLVNSGTKCGDGMVCSNGECIEMEKAYNSTICSSPCDENDVDDNEPECQCEEGSIITEWG
EALNLTSVSIMVIVLVMVIIGVGLVILLIRYQKCIKMKQVQSSPREIRGVENKGYFPEEH
QTRSEPILTDIHPLHTTAESLERVPSSFSSPHYITLKSVSKDSRGIADPKQTDNVNLNLD
TQSGCERLG
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccacaggaatattttggatgactgtccttatttctcacattcaagaaaggggg
attgttggagtagagggtcaagaactggttcatcctaaaaagcttcccttgctacacaaa
cgggatcttgaacgcatccatgactctgacataccggaggaatatgaagaagaattgttg
tatgaaataaaattgggcaaaaaaactttaatccttcaccttctgaaagcaagggaattc
ctcagttcaaattacagtgaaacatactacaacgtaaagagagaagtgttcaccaagcat
ccacagatcttggatcactgtttttaccaaggctccatcattcatgaatttgattctgct
gctagtatcagcacttgcaatggtctgaggggtttcttcagggtgaatgaccagcggtat
ctcatcgaaccagtaaaatactcagatgatggagaacatttggtgtacaaatacaatgtc
aaggcaccctatgctaccaatcactcctgcgtggggctcaattttactaagaagtctgct
ctgatagatgttgagaatatagaagaacataacgcagaagaccatcacaaagaaaagttc
attgaactgtttgttgttgctgatgagtatgtgtaccgcaggaacaataaaccccaaaac
aagctaagaaaacgaatttgggggatggtcaattttgtcaacatgatttataaaaccttg
aacattcatgtgactttagctggttttgaaatatggtcagctggggacaagatagaaata
gtgtccaatctagaaagtaccttattgcatttttcaacttggcaagaaacagttctcaaa
aaaaggaaggattttgatcatgtgattttattgagtgggaagtggctctacacatctatg
caaggaattgcttacccaggagggatatgccagatccttcgttcatgcagtgttgttaag
gatcttctaccagatgtaaatataattgggaacagaatggcacatcagctgggacacagc
ctggggatgcagcatgatggctttccatgcacctgtcctttggggaaatgtgtgatgggc
gatggaagcatccctgcaataaaattcagcaaatgcagccaaacccaataccagcaattt
ctgcaggatcagaaaccagcatgcatactcaacaacccctttcccgaagaattcaatgat
tatcctttctgtgggaacaagaaggtggatgagggagaagagtgtgactgtgggccagtt
caggagtgcaccaatccctgctgtgacgcacacaaatgtgtcctgaagccaggattcact
tgtgtggaaggagagtgctgtgaatcatgtcagatgaagaaagaaggggccgtatgcaga
ctagcgaaaaatgaatgcgatatttctgaagtgtgtactggctactcccctgagtgccct
aaagacgagttccaagccaacgggtttccttgcaggaatggagaaggctactgctttatg
gggctgtgtcccacccggaatgagcagtgctcagagttattcattggcggagcagaagag
agtcacagcctttgctacaggatgaataaaaaaggaaacagatttggatactgcaaaaat
aagggcaacacatttgttccctgtgaagagaaagatctcaaatgtgggaagatatactgc
tcgggaggccggccctcatcccgccttggagaagataaagcctataatcttaagaatgtg
aagcagaacgtgaccatcaaatgcagaaccatgtttttacaccacaattctagagacatg
ggcctggttaattctggaacaaaatgtggagatggaatggtttgcagcaatggtgaatgt
atagaaatggagaaggcctacaactcaaccatctgctcctctccgtgcgatgaaaacgat
gtggatgacaacgaacctgagtgccagtgtgaggaaggatcaataattacggagtgggga
gaagccttaaaccttaccagtgtctccatcatggtcattgtgcttgtcatggttattatt
ggtgttggacttgtcatattactaatccgttaccagaaatgcattaagatgaagcaagtt
caaagctctcctcgagaaatacggggggtagaaaataagggatactttcctgaagaacac
cagacgaggagtgagccaatcttgaccgatatccatcccctacataccactgcagagtcc
ctggaaagagttccttccagcttttcaagtcctcactatatcacactgaaatctgtcagc
aaggactcaagaggaattgcagaccctaagcaaactgataatgtgaatttgaacctggat
acccaaagtggctgtgaaagactgggctaa

DBGET integrated database retrieval system