KEGG   Mus musculus (mouse): 11512Help
Entry
11512             CDS       T01002                                 

Gene name
Adcy6, AC6, mKIAA0422
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04727  GABAergic synapse
mmu04742  Taste transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing's syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04962  Vasopressin-regulated water reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05032  Morphine addiction
mmu05166  HTLV-I infection
mmu05200  Pathways in cancer
mmu05414  Dilated cardiomyopathy (DCM)
Module
mmu_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    11512 (Adcy6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    11512 (Adcy6)
   04371 Apelin signaling pathway
    11512 (Adcy6)
   04072 Phospholipase D signaling pathway
    11512 (Adcy6)
   04024 cAMP signaling pathway
    11512 (Adcy6)
   04022 cGMP - PKG signaling pathway
    11512 (Adcy6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    11512 (Adcy6)
  Cellular community - eukaryotes
   04540 Gap junction
    11512 (Adcy6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    11512 (Adcy6)
   04062 Chemokine signaling pathway
    11512 (Adcy6)
  Endocrine system
   04911 Insulin secretion
    11512 (Adcy6)
   04923 Regulation of lipolysis in adipocyte
    11512 (Adcy6)
   04912 GnRH signaling pathway
    11512 (Adcy6)
   04913 Ovarian Steroidogenesis
    11512 (Adcy6)
   04915 Estrogen signaling pathway
    11512 (Adcy6)
   04914 Progesterone-mediated oocyte maturation
    11512 (Adcy6)
   04921 Oxytocin signaling pathway
    11512 (Adcy6)
   04926 Relaxin signaling pathway
    11512 (Adcy6)
   04918 Thyroid hormone synthesis
    11512 (Adcy6)
   04928 Parathyroid hormone synthesis, secretion and action
    11512 (Adcy6)
   04916 Melanogenesis
    11512 (Adcy6)
   04924 Renin secretion
    11512 (Adcy6)
   04925 Aldosterone synthesis and secretion
    11512 (Adcy6)
   04927 Cortisol synthesis and secretion
    11512 (Adcy6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11512 (Adcy6)
   04270 Vascular smooth muscle contraction
    11512 (Adcy6)
  Digestive system
   04970 Salivary secretion
    11512 (Adcy6)
   04971 Gastric acid secretion
    11512 (Adcy6)
   04972 Pancreatic secretion
    11512 (Adcy6)
   04976 Bile secretion
    11512 (Adcy6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    11512 (Adcy6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11512 (Adcy6)
  Nervous system
   04724 Glutamatergic synapse
    11512 (Adcy6)
   04727 GABAergic synapse
    11512 (Adcy6)
   04725 Cholinergic synapse
    11512 (Adcy6)
   04723 Retrograde endocannabinoid signaling
    11512 (Adcy6)
  Sensory system
   04742 Taste transduction
    11512 (Adcy6)
   04750 Inflammatory mediator regulation of TRP channels
    11512 (Adcy6)
  Aging
   04211 Longevity regulating pathway - mammal
    11512 (Adcy6)
   04213 Longevity regulating pathway - multiple species
    11512 (Adcy6)
  Environmental adaptation
   04713 Circadian entrainment
    11512 (Adcy6)
   04714 Thermogenesis
    11512 (Adcy6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11512 (Adcy6)
  Substance dependence
   05032 Morphine addiction
    11512 (Adcy6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    11512 (Adcy6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    11512 (Adcy6)
  Infectious diseases
   05166 HTLV-I infection
    11512 (Adcy6)
  Drug resistance
   01522 Endocrine resistance
    11512 (Adcy6)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     11512 (Adcy6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA DUF5134
Motif
Other DBs
NCBI-GeneID: 11512
NCBI-ProteinID: NP_031431
MGI: 87917
Ensembl: ENSMUSG00000022994
UniProt: Q01341 F8VQ52
Position
15; 15 F1
AA seq 1168 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRPRHANRASGFCAPRYMSCLKNAEPPSPTPAAHT
RCPWQDEAFIRRAGPGRGVELGLRSVALGFDDTEVTTPMGTAEVAPDTSPRSGPSCWHRL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLTFHAAPAQPQPAYVA
LLTCASVLFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPHSPSAGLWCP
VFFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWQLNSSDPFLWKQLGANVVLFLCTNAI
GVCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAVRENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQCIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLVFPYSTLILGIYAAIFLLLLVTVLICAVCSC
GSFFPKALQRLSRNIVRSRVHSTAVGIFSVLLVFISAIANMFTCNHTPIRTCAARMLNLT
PADVTACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNVLLSLLASSVFLHISSIGKLA
MTFILGFTYLVLLLLGPPAAIFDNYDLLLGVHGLASSNETFDGLDCPAVGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggttcccaaagtggatgaacggaaaacagcttggggg
gaacgcaatgggcagaagcgcccacgccacgcgaatcgagccagtggcttctgcgcacct
cgctacatgagctgcctcaagaatgcggagccacccagccccactcctgcagctcacact
cggtgcccctggcaggatgaagccttcatcaggagggcgggcccgggcaggggtgtggag
ctggggctgcggtcagtggccttggggtttgacgacactgaggtgaccacaccgatgggc
acagctgaagtggcaccggatacatcgcctcggagcggtccgtcctgctggcaccggctt
gtgcaggtgttccagtctaagcagttccgctctgccaagctggagcggctgtaccagcgg
tacttcttccagatgaaccagagcagcctcacgctgctcatggcggtgctggtgctgctc
atggctgtactgttgactttccacgctgcgcctgcccagcctcagcctgcttacgtggcc
ctgctgacctgtgcctctgtcctttttgtggtactcatggtggtgtgtaaccgacacagc
ttccgccaggactccatgtgggtggtgagctatgtggtcctgggcatcctagcagccgtg
caagtcgggggtgccctggcagccaatccacacagcccctcggcgggcctttggtgcccc
gtgttcttcgtctacatcacctacactcttcttcccattcgcatgcgagccgcagtactc
agcggcctgggcctctctactctgcatttgattttggcctggcagctcaacagcagcgac
cccttcctttggaagcagctcggtgctaacgtggtgctcttcctctgcaccaatgccatc
ggtgtctgcacacactaccctgctgaagtgtctcagcgccaagcctttcaggagacccga
ggttacatccaggcgcggctgcacctgcagcatgagaaccgtcagcaggaacggctgctg
ctatcggtgttgccccagcacgttgccatggagatgaaagaagacatcaacacaaaaaaa
gaggacatgatgttccataagatctacatccagaagcatgataatgtcagcatcctgttt
gcggacattgagggcttcaccagcctggcctcccagtgcactgcacaggaactggtcatg
accttgaatgagctctttgcccggtttgacaagctggctgcggtgagggagaatcactgt
ctgaggatcaagatcttaggagactgttactactgcgtgtcagggctgcccgaggcccgg
gcagatcacgcccactgctgtgtggagatgggggtagacatgatcgaagccatctcgctg
gtgcgtgaggtaacaggtgtgaacgtgaacatgcgtgtgggcatccacagcggacgtgtg
cattgcggcgtccttggcctacggaaatggcagtttgatgtctggtcaaacgatgtgacc
ctggctaaccacatggaggccgggggccgggccggccgcatccacatcactcgggctaca
ctgcagtacttgaacggggactatgaggtggagccaggccgtggtggtgaacgcaatgcg
tacctcaaggagcagtgcattgagaccttcctcatacttggcgccagccaaaaacggaaa
gaggagaaagccatgctggccaagcttcagcggacacgggccaactccatggaaggactg
atgccccgctgggttcctgaccgtgccttctcccggaccaaggactctaaggcattccgc
cagatgggcattgatgattctagcaaagacaaccggggtgcccaagatgctctgaaccct
gaagatgaggtggatgagttcctgggccgagccatcgatgcccgaagcatcgaccaactg
cgtaaggaccatgtgcgccggttcctgctcaccttccagagagaggatcttgagaagaag
tattcacggaaagtagatcctcgcttcggagcctacgtcgcctgtgccctcctggttttt
tgcttcatctgttttatccagctccttgtgttcccatactccaccctgatactcgggatt
tatgccgctatcttcctgctgttgctggtcactgtgctgatctgtgccgtgtgctcctgc
ggttctttcttccccaaggccctgcaacgcctgtcccgcaatattgtccgctcacgggtg
cacagcaccgcggttggaatcttctcggttctgcttgtgttcatctctgccatcgccaac
atgtttacctgtaatcacaccccaataaggacctgcgcggcccggatgctgaacttaaca
ccagcggatgtcaccgcctgccacctacaacagctcaattactctctgggactggatgct
cccctgtgtgagggcaccgcacccacctgcagcttccctgagtacttcgtcgggaacgtg
ctgctgagtcttctagccagctctgtcttcctacacatcagcagcatcggcaagctggcc
atgaccttcatcttggggttcacctacttggtgctgcttttgctgggtcccccggccgcc
atctttgacaactatgatctactgcttggcgtccatggcttggcttcctccaatgagacc
tttgatgggctggactgcccagctgtggggagggtagcgctcaaatatatgacccccgtg
attctgctggtgtttgccctggcactgtatctgcatgcacaacaggtggaatcgactgcc
cgcctggacttcctgtggaagttacaggcaacaggggagaaggaggagatggaggagcta
caggcatacaaccggaggttgctgcataacattcttcccaaggacgtggccgcccacttc
ctggcccgggaacgccgcaacgatgagctgtactaccagtcgtgtgaatgtgtggctgtc
atgtttgcctccatcgccaatttctcggagttctacgtggagctcgaggcaaacaacgag
ggcgtggagtgcctgcggctgctcaatgagatcatcgcagactttgacgagatcatcagt
gaggagagattccggcagttggagaagatcaagaccatcggtagcacctacatggccgcc
tctgggctaaatgccagcacctatgaccaggtcggccgctcacacatcacggcgctggct
gactatgccatgcggctcatggagcagatgaaacacatcaatgaacactctttcaacaat
ttccagatgaagatcgggttgaacatgggtccggttgtagcaggcgtcattggggcccga
aagccacagtatgacatctggggaaataccgtgaatgtttccagtcgtatggacagcact
ggagttcctgaccgaatacaggtgactacggacctataccaggttctagctgccaagggc
taccagctggagtgtcgaggggtggtcaaggtgaagggaaagggggagatgaccacctac
ttcctcaacgggggccccagcagttag

DBGET integrated database retrieval system