KEGG   Mus musculus (mouse): 11519Help
Entry
11519             CDS       T01002                                 

Gene name
Add2, 2900072M03Rik, add97
Definition
(RefSeq) adducin 2 (beta)
  KO
K18622  adducin
Organism
mmu  Mus musculus (mouse)
Brite
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     11519 (Add2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldolase_II DUF3614 Occludin_ELL
Motif
Other DBs
NCBI-GeneID: 11519
NCBI-ProteinID: NP_001258786
MGI: 87919
Ensembl: ENSMUSG00000030000
Vega: OTTMUSG00000056411
UniProt: Q9QYB8
Position
6 C3-D1; 6 37.55 cM
AA seq 725 aa AA seqDB search
MSEDTVPEAASPPPSQGQHYFDRFSEDDPEYLRLRNRAADLRQDFNLMEQKKRVTMILQS
PSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHAVFPASSMNFSMMTPINDLHT
ADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEV
TASSLIKVNILGEVVEKGSSCFPVDTTGFSLHSAIYAARPDVRCAIHLHTPATAAVSAMK
CGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGMVALGDTVE
EAFYKVFHLQAACEVQVSALSSAGGTENLILLEQEKHRPHEVGSVQWAGSTFGPMQKSRL
GEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGVPVPALR
QHAQKQQKEKTRWLNTPNTYLRVNVADEVQRNMGSPRPKTTWMKADEVEKSSSGMPIRIE
NPNQFVPLYTDPQEVLDMRNKIREQNRQDIKSAGPQSQLLASVIAEKSRSPSTESQLMSK
GDADTKDESEETVPNPFSQLTDQELEEYKKEVERKKLEQEQEGEKDIATEKPGSPVKSTP
ASPVQSPSKAGTKSPAVSPSKTSEDTKKTEVSEANTEPEPVKPEGLVVNGKEEEPSVEEA
LSKGLGQMTTNADTDGDSYKDKTESVTSGPLSPEGSPSKSPSKKKKKFRTPSFLKKSKKK
EKVES
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggacacggttcccgaggcggcctccccgccaccctctcaggggcagcactac
tttgaccggttctctgaagatgatcctgagtacttgcgacttcgcaaccgtgcagctgac
ctgcgacaggacttcaacttgatggagcagaagaagagggtcaccatgatcctgcagagc
ccttctttcagggaggagctggaaggcctcatccaggagcaaatgaagaagggcaacaac
tcctccaacatctgggccctccgacagatcgcggacttcatggccagcacctcccacgca
gtcttcccagcttcttccatgaacttctccatgatgacacccatcaacgacctccacact
gccgactccctgaacctggccaagggggagaggcttatgcggtgcaagatcagcagcgtc
taccgtctcctggacctctacggctgggcgcagctcagtgacacctacgtcacgctgaga
gtgagcaaggagcaggaccacttcctgatcagccccaagggggtttcctgcagcgaggtc
acagcctccagcctgattaaagtgaacattctgggagaggtggtggagaagggcagcagt
tgcttcccggtggacaccacgggcttcagtctgcactcagccatctatgccgccaggccc
gacgtgcggtgtgccatccacctgcacacgcctgccaccgcagcggtgtcagctatgaag
tgcggcctcctgccggtctcccataatgccctgctggtgggggacatggcctactatgac
ttcaatggggaaatggagcaggaagctgaccgaatcaacttgcagaagtgccttggaccc
acctgcaagattctggtgctaagaaaccatggcatggtcgccctgggtgacaccgtggag
gaagctttctacaaggtcttccatctgcaggctgcgtgtgaggtacaggtgtcggctctg
tccagtgctgggggcactgagaacctcatcctcttggagcaagagaaacaccggccgcac
gaggtgggctctgtgcagtgggccggcagcaccttcgggcccatgcagaagagccggctg
ggagagcatgaatttgaagccctcatgaggatgctggacaatttaggctacagaacaggc
tatacgtaccgccacccctttgtccaagagaaaaccaaacacaaaagtgaagtggagatc
ccagccacagtcactgcctttgtgtttgaagaggatggagtcccagtccccgccctgcgc
cagcacgcccagaagcagcagaaggaaaagacccgctggcttaacactcccaacacctac
ctgcgggtgaacgtggctgacgaggtgcagaggaacatgggcagtccccgaccaaagacc
acgtggatgaaggctgatgaagtggaaaagtccagcagcggcatgcccatacggattgaa
aacccaaaccaatttgtgcctctctacactgacccccaggaagttctggacatgaggaac
aagattcgagagcaaaaccgacaagacataaagtcagccgggcctcagtctcagctcttg
gccagtgtcatcgcagagaagagccggagtccgtctacagagagccagctgatgtccaag
ggcgatgcagataccaaagatgaatcggaggagacggtgcccaaccccttcagccaactc
actgaccaggagctggaggagtacaagaaggaggtggaaaggaagaagctagaacaggag
caggaaggggagaaggacatagccacagagaagcctggttcacctgtaaagtccacacct
gcatccccagtgcagagcccatcaaaagccgggaccaagagcccagcggtctctccttcc
aagacttcagaggataccaagaagacagaagtcagcgaagccaacacagagcctgagcca
gtgaaaccagaagggctggtggtgaatgggaaggaggaggagccgagcgtagaagaggcc
ctcagcaaaggactgggccagatgaccaccaacgctgacactgatggcgacagctacaag
gacaaaaccgagtcagttaccagtggccccttgtccccagagggctcgccctctaagtca
ccctccaaaaagaaaaagaaattccgaaccccctcgttcctgaagaaaagcaagaagaag
gagaaggtggaatcctga

DBGET integrated database retrieval system