KEGG   Mus musculus (mouse): 11520Help
Entry
11520             CDS       T01002                                 

Gene name
Plin2, AA407157, ADPH, Adfp, Adrp
Definition
(RefSeq) perilipin 2
  KO
K17284  
perilipin-2
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    11520 (Plin2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   11520 (Plin2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C4; 4 40.69 cM
AA seq 425 aa AA seqDB search
MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRSVCEMAEKGVKTVTSA
AMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEIVASARGAVTGAKDVVT
TTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTVLGMVQFMNSGVDNAITK
SELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLSTKLCSRAYHQALSRVKEA
KQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYVSWVEWKRSIGYDDTDESHC
VEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQAKHLGVMAGDIYSVFRNAAS
FKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWLVGPFYPQSTEVNKASLKVQQS
EVKAQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcagtagtggatccgcaacagagcgtggtgatgagagtggccaacctgccc
ttggtgagctctacctacgaccttgtgtcctccgcttatgtcagtacaaaggatcagtac
ccgtatttgagatccgtgtgtgagatggccgagaagggcgtgaagaccgtgacctctgcg
gccatgacaagtgccctgcccatcatccagaagctggagccacaaattgcggttgccaat
acctatgcctgcaaggggctagacaggatggaggaaagactgcctattctgaaccagcca
acgtccgagattgttgccagtgccagaggtgccgtaactggggcgaaggatgtggtgacg
actaccatggctggagccaaggattctgtagccagcacagtctcaggggtggtggataag
accaaaggagcagtgactggcagcgtggaaaggaccaagtctgtggtcaatggcagcatc
aatacagttttggggatggtgcagttcatgaacagtggagtagataatgccatcaccaag
tcggagctgctggtagaccagtacttccctctcactcaggaggagctggagatggaagca
aaaaaggtggaaggatttgatatggttcagaagccgagcaactatgaacggctggagtcc
ctgtctaccaagctctgctctcgggcttatcaccaggctctcagcagggttaaagaggcc
aaacaaaagagccaggagaccatttctcagctccactccactgtccacctgattgaattc
gccaggaagaatatgcacagtgccaaccagaaaattcagggtgctcaggataagctctat
gtctcgtgggtggagtggaagagaagcatcggctacgacgacaccgatgagtcccactgt
gttgagcacatcgagtcacgtactctggctatcgcccgcaacctgacccagcagctccag
actacatgccagactgtcctggtcaacgcccaagggttaccacagaacattcaagatcag
gccaaacacttgggggtgatggcaggcgacatctactccgtattccgcaatgctgcctcc
tttaaggaagtgtccgatggcgtcctcacatctagcaaggggcagctgcagaaaatgaag
gaatccttagatgaagttatggattactttgttaacaacacgcctctcaactggctggta
ggtcccttttatcctcagtctaccgaggtgaacaaggccagcctgaaggtccagcagtct
gaggtcaaagctcagtaa

DBGET integrated database retrieval system