KEGG   Mus musculus (mouse): 11522Help
Entry
11522             CDS       T01002                                 

Gene name
Adh1, ADH-AA, AI194826, Adh-1, Adh-1-t, Adh-1e, Adh-1t, Adh-3e, Adh1-e, Adh1-t, Adh1tl, Adh3-e
Definition
alcohol dehydrogenase 1 (class I) (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11522 (Adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    11522 (Adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    11522 (Adh1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    11522 (Adh1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    11522 (Adh1)
   00982 Drug metabolism - cytochrome P450
    11522 (Adh1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    11522 (Adh1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     11522 (Adh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 G3; 3 64.16 cM
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSGTLVT
PLPAVLGHEGAGIVESVGEGVTCVKPGDKVIPLFSPQCGECRICKHPESNFCSRSDLLMP
RGTLREGTSRFSCKGKQIHNFISTSTFSQYTVVDDIAVAKIDGASPLDKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHAACGVSVVVGVPPNAQ
NLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKKFPLDPLITHVLPFEKINEAF
DLLRSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcgggaaaagtgatcaaatgcaaagctgcggtgctatgggagcttcacaaa
cccttcaccatcgaggacatagaagtcgcaccccccaaggcccatgaagttcgaattaag
atggtggccactggtgtctgccgctcagacgatcacgtggttagtggaaccctggtcaca
cctcttcctgcagttttaggccatgagggagcaggcattgttgagagcgttggagaaggg
gtgacttgtgtgaaaccaggtgataaagtcattccactcttttcccctcagtgtggagaa
tgcaggatttgcaagcacccggaaagcaacttttgtagccgaagcgatctgctaatgcct
cgggggactttgcgcgaaggcaccagcaggttctcctgcaagggaaagcagatccacaac
tttatcagcaccagcaccttctcccagtacaccgtggtagatgatatagcagtggccaaa
atcgatggagcttcaccactggacaaagtctgcctcatcggctgtgggttctcaactggc
tatggctctgccgtcaaagtcgccaaggtgaccccaggctccacatgtgccgtgtttggc
ctcggaggtgtcggtctgtctgtcatcattggctgtaaagcagcaggagcagccaggatc
attgctgtggacatcaacaaggacaagtttgccaaggccaaagagttgggtgcaactgag
tgcatcaaccctcaagactacagcaaacccatccaggaagttctccaggagatgaccgac
ggaggggtggacttttcgtttgaagtcatcggccgccttgacaccatgacttctgccctg
ctgagctgccatgcagcatgtggtgtaagcgtcgtcgtaggagtgcctcccaatgcccag
aacctctccatgaaccccatgttgctgctgctgggacgcacctggaagggagcaatattt
ggcgggtttaagagtaaagattctgtccctaaacttgtggctgacttcatggctaagaag
tttccgttggacccgttaattacccatgttttacctttcgagaaaataaatgaagcattt
gacctgcttcgttctggaaagagcatccgtaccgtcctgactttctga

DBGET integrated database retrieval system