KEGG   Mus musculus (mouse): 11522Help
Entry
11522             CDS       T01002                                 

Gene name
Adh1, ADH-A2, ADH-AA, AI194826, Adh-1, Adh-1-t, Adh-1e, Adh-1t, Adh-3e, Adh1-e, Adh1-t, Adh1tl, Adh3-e
Definition
(RefSeq) alcohol dehydrogenase 1 (class I)
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00071  Fatty acid degradation
mmu00350  Tyrosine metabolism
mmu00830  Retinol metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11522 (Adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    11522 (Adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    11522 (Adh1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    11522 (Adh1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    11522 (Adh1)
   00982 Drug metabolism - cytochrome P450
    11522 (Adh1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    11522 (Adh1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     11522 (Adh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 11522
NCBI-ProteinID: NP_031435
MGI: 87921
Ensembl: ENSMUSG00000074207
Vega: OTTMUSG00000034747
UniProt: P00329 Q3UKA4
Position
3 G3; 3 64.16 cM
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSGTLVT
PLPAVLGHEGAGIVESVGEGVTCVKPGDKVIPLFSPQCGECRICKHPESNFCSRSDLLMP
RGTLREGTSRFSCKGKQIHNFISTSTFSQYTVVDDIAVAKIDGASPLDKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHAACGVSVVVGVPPNAQ
NLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKKFPLDPLITHVLPFEKINEAF
DLLRSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcgggaaaagtgatcaaatgcaaagctgcggtgctatgggagcttcacaaa
cccttcaccatcgaggacatagaagtcgcaccccccaaggcccatgaagttcgaattaag
atggtggccactggtgtctgccgctcagacgatcacgtggttagtggaaccctggtcaca
cctcttcctgcagttttaggccatgagggagcaggcattgttgagagcgttggagaaggg
gtgacttgtgtgaaaccaggtgataaagtcattccactcttttcccctcagtgtggagaa
tgcaggatttgcaagcacccggaaagcaacttttgtagccgaagcgatctgctaatgcct
cgggggactttgcgcgaaggcaccagcaggttctcctgcaagggaaagcagatccacaac
tttatcagcaccagcaccttctcccagtacaccgtggtagatgatatagcagtggccaaa
atcgatggagcttcaccactggacaaagtctgcctcatcggctgtgggttctcaactggc
tatggctctgccgtcaaagtcgccaaggtgaccccaggctccacatgtgccgtgtttggc
ctcggaggtgtcggtctgtctgtcatcattggctgtaaagcagcaggagcagccaggatc
attgctgtggacatcaacaaggacaagtttgccaaggccaaagagttgggtgcaactgag
tgcatcaaccctcaagactacagcaaacccatccaggaagttctccaggagatgaccgac
ggaggggtggacttttcgtttgaagtcatcggccgccttgacaccatgacttctgccctg
ctgagctgccatgcagcatgtggtgtaagcgtcgtcgtaggagtgcctcccaatgcccag
aacctctccatgaaccccatgttgctgctgctgggacgcacctggaagggagcaatattt
ggcgggtttaagagtaaagattctgtccctaaacttgtggctgacttcatggctaagaag
tttccgttggacccgttaattacccatgttttacctttcgagaaaataaatgaagcattt
gacctgcttcgttctggaaagagcatccgtaccgtcctgactttctga

DBGET integrated database retrieval system