KEGG   Mus musculus (mouse): 11529Help
Entry
11529             CDS       T01002                                 

Gene name
Adh7, AI325182, Adh-3, Adh-3e, Adh-3t, Adh3, Adh3-e, Adh3-t, Adh4, Adt-1
Definition
(RefSeq) alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00071  Fatty acid degradation
mmu00350  Tyrosine metabolism
mmu00830  Retinol metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11529 (Adh7)
  Lipid metabolism
   00071 Fatty acid degradation
    11529 (Adh7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    11529 (Adh7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    11529 (Adh7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    11529 (Adh7)
   00982 Drug metabolism - cytochrome P450
    11529 (Adh7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    11529 (Adh7)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     11529 (Adh7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 11529
NCBI-ProteinID: NP_033756
MGI: 87926
Ensembl: ENSMUSG00000055301
Vega: OTTMUSG00000052803
UniProt: Q64437 Q9D748
Position
3 G3; 3 64.13 cM
AA seq 374 aa AA seqDB search
MGTAGKVIKCKAAVLWGVNQPFSIEEIEVAPPKAKEVRVKILATGICRTDDHIIKGSMVS
KFPVIVGHEAVGVVESVGEGVTTVRPGDKVIPLFLPQCRECNACLNPEGNLCIRSDLTGR
GVLADGTTRFTCKGKPVQHFMNTSTFTEYTVLDESSVAKVDGAAPPEKACLIGCGFSTGY
GAAVKTAKVTPGSTCVVFGLGGVGLSVIMGCKAAGASRIIGIDINKDKFQKALAVGATEC
ISPKDSTKPISEVLSDMTGNTIQYTFEVIGRLETMVDALSSCHMNYGTSVVVGAPPSAKM
LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTLPFNNINEGFE
LLYSGKSIRTVLTF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgctggaaaagttattaagtgcaaagcggctgtcctatggggagtgaaccag
cctttctccattgaggaaatcgaggtggccccaccaaaggctaaggaagtccgtgttaag
attttggccacaggaatctgtcgcacagatgaccatataataaaaggatcgatggtgtct
aagtttccagtgattgtgggacatgaagcagttggggttgtggagagtgttggagaaggg
gtcactacagtgagaccaggtgacaaagtcatccccctctttctaccacagtgtagagaa
tgcaacgcctgcctgaacccagagggcaatctctgcattaggagcgatctgacaggccgt
ggagtattggctgatggcactaccagattcacctgcaagggcaaaccggtccagcacttc
atgaacaccagcaccttcactgagtacacggtgctggacgaatcctccgtagcgaaggtt
gacggtgcggctccgcctgagaaagcctgcttgatcggctgtggattttccacgggttat
ggagctgctgttaaaactgccaaggtcacccctggctccacttgtgttgtctttggcctg
ggaggagttggcctgtcagtcatcatgggctgtaaagcagctggtgcctccaggatcatt
ggaatcgacatcaacaaagacaaattccagaaagctctggccgtaggtgccacagagtgt
atcagtcccaaggactctaccaagcccatcagtgaggtgctatccgacatgacaggcaac
accatacagtatacttttgaagttattgggcgtcttgagaccatggttgatgccctctca
tcttgccatatgaactatgggaccagtgtggtggttggtgctcctccgtcagccaagatg
ctcacctatgacccaatgctgctcttcactgggcgtacgtggaagggctgcgtctttgga
gggtggaagagcagagatgatgtacctaaactggtgactgagttcctggaaaagaagttt
gacctggaccagttgataacccacaccttgccttttaataacatcaatgaaggatttgaa
ttgctgtattcggggaaaagcattcggactgtcctgacattttga

DBGET integrated database retrieval system