KEGG   Mus musculus (mouse): 11549Help
Entry
11549             CDS       T01002                                 

Gene name
Adra1a, Adra1c
Definition
adrenergic receptor, alpha 1a
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    11549 (Adra1a)
   04022 cGMP - PKG signaling pathway
    11549 (Adra1a)
   04152 AMPK signaling pathway
    11549 (Adra1a)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11549 (Adra1a)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11549 (Adra1a)
   04270 Vascular smooth muscle contraction
    11549 (Adra1a)
  Digestive system
   04970 Salivary secretion
    11549 (Adra1a)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    11549 (Adra1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14 D1; 14
AA seq 427 aa AA seqDB search
MVLLSENASEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETICQINE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPN
FKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQAVEGQHRGMVRIPVGSGETFYKISKTDGVREWKFFSSMPQGSARITMPKDQSACT
TARGFYP
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttctttctgaaaatgcttctgaaggctccaactgcacccacccgccagcacag
gtgaacatttctaaggccattctacttggggtgatcttggggggcctcatcattttcggg
gtcttggggaatattttagtgatcctctcggtggcctgtcatcggcatctgcactcggtg
actcactactacattgtcaacctggctgtggcagacctcctcctcacctccaccgtgctg
cccttctctgccatctttgagatcctgggctactgggcctttggcagggtgttctgcaac
atctgggcggcggtggacgtcttatgctgcacagcgtccatcatgggcctctgcatcatc
tccatcgaccgatacattggtgtgagctacccgctgcgctaccccaccattgtcacccag
aggaggggcgtcagggctctgctctgcgtctgggcgctttccttggtcatctccatcgga
cccctgttcggctggaggcagcaggctccggaggatgagaccatctgccaaatcaatgag
gagccaggatacgtgctgttctcagcgctgggctctttctacgtgccactgaccatcatc
ctggttatgtactgtcgagtctacgtggtagccaagagagaaagccgaggcctcaagtcc
ggcctcaagaccgacaagtcagactcagagcaagtgacgctccgtatccaccgtaaaaat
gtccctgcagaaggcagcggagtaagcagtgccaagaataagactcacttctccgtgagg
ctgctcaagttttcccgagagaagaaagccgccaagacgctgggcattgtggtgggatgc
ttcgtcctctgctggctgccattcttcctcgtgatgcccattgggtccttcttcccgaat
ttcaagccaccggaaacagttttcaaaatagtattttggcttgggtacctaaatagttgc
atcaaccctatcatatacccatgctccagccaggagttcaagaaagcctttcagaatgtg
ctgcgaatccagtgtcttcgcagaaggcagtcttccaagcatgccctgggctacactctg
cacccacccagccaggctgtagaggggcagcacagaggcatggtgcgtatcccggtgggc
tcaggagagactttctataagatctccaagacagatggagtccgtgaatggaagtttttc
tcttccatgccccagggatcggccaggattaccatgccgaaggaccaatccgcctgtacc
acagcccggggcttttatccatga

DBGET integrated database retrieval system