KEGG   Mus musculus (mouse): 11552Help
Entry
11552             CDS       T01002                                 

Gene name
Adra2b, Adra-2b, [a]2B, alpha2-C2, alpha2B
Definition
adrenergic receptor, alpha 2b
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    11552 (Adra2b)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11552 (Adra2b)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    11552 (Adra2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 F1; 2 61.95 cM
AA seq 453 aa AA seqDB search
MSGPAMVHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLA
AADILVATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVS
RALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPHGLPQCELNQEAWYILA
SSIGSFFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPHPAAGGVPASAKVP
TLVSPLSSVGEANGHPKPPREKEEGETPEDPEARALPPNWSALPRSVQDQKKGTSGATAE
KGAEEDEEEVEECEPQTLPASPASVFNPPLQQPQTSRVLATLRGQVLLSKNVGVASGQWW
RRRTQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYC
NSSLNPVIYTIFNQDFRRAFRRILCRQWTQTGW
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccccgccatggtccaccaggagccctactcggtgcaggccaccgccgccatc
gcgtcggccatcacctttctcatcctcttcaccattttcggcaatgcgctggtaattctg
gctgtgttgaccagccgctctctccgtgcaccacaaaacctcttcctggtgtcactggca
gcagccgacatcctagtggctactcttatcatccctttctctctggccaacgagctgctg
ggctattggtacttctggcgtgcgtggtgcgaggtctacctggcgctagacgtgctcttc
tgtacctcctccatcgtgcacctgtgtgccatcagtctggacagatactgggcagtgagc
cgagcattggagtacaactccaagcgcactccacgccgcatcaaatgcatcatcctcacc
gtgtggctcattgcagccgtcatttctctaccgcccctcatctacaagggcgaccagcgc
ccagagccccacgggctcccccagtgtgagctcaaccaagaagcctggtacatcttggct
tccagcatcggatctttttttgctccctgcctcatcatgattctcgtctacctgcgaatc
tatgtaattgccaaacgcagccactgcagaggtctcggagctaagaggggctctggggag
ggtgagtccaagaagccccatccggccgccgggggagttccagcctcggctaaagtgccc
accctggtctctcctctatcttctgtcggagaggctaatggacaccccaagcctccaagg
gagaaggaggagggggagacccctgaagatcccgaagccagggctttgccacccaattgg
tctgccctgcccagatcagtccaggaccagaagaaggggactagtggggcaactgcagag
aagggagctgaagaggatgaagaggaggtggaagaatgtgaaccccaaacactgccagct
tctcctgcctcagtattcaacccacccttgcagcagcctcagacttcccgggtgctggcc
acgctacgtggccaggtgcttctgagcaagaatgtgggtgtggccagtgggcagtggtgg
cgccgtcggacacagctgagccgagagaagaggttcacctttgtgctggcggtggtcatt
ggtgtttttgtggtctgttggtttcctttcttcttcagctacagcctgggggccatctgc
ccacagcactgcaaggtaccccatggcctcttccagttcttcttctggattggctactgc
aacagctctttgaatcctgtcatctacaccatcttcaaccaggacttccgccgtgccttt
cgaaggatcctttgccggcagtggacccagactggctggtga

DBGET integrated database retrieval system