KEGG   Mus musculus (mouse): 11601Help
Entry
11601             CDS       T01002                                 

Gene name
Angpt2, Agpt2, Ang-2, Ang2
Definition
angiopoietin 2
Orthology
K05466  
angiopoietin 2
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    11601 (Angpt2)
   04015 Rap1 signaling pathway
    11601 (Angpt2)
   04066 HIF-1 signaling pathway
    11601 (Angpt2)
   04151 PI3K-Akt signaling pathway
    11601 (Angpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 A1.3; 8 10.3 cM
AA seq 496 aa AA seqDB search
MWQIIFLTFGWDLVLASAYSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPY
MSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQ
TAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSE
INKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVN
NSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTL
TFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFV
SQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPG
SDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagatcattttcctaacttttggctgggatcttgtcttggcctcagcctacagt
aactttaggaagagcgtggacagcacaggcagaaggcagtaccaggtccagaacggaccc
tgcagctacacgttcctgctgccggagaccgacagctgccgatcttcctccagcccctac
atgtccaatgccgtgcagagggatgcacccctcgactacgacgactcagtgcaaaggctg
caggtgctggagaacattctagagaacaacacacagtggctgatgaagctggagaattac
attcaggacaacatgaagaaggagatggtggagatccaacagaatgtggtgcagaaccag
acagctgtgatgatagagattggaaccagcttgctgaaccagacagcagcacaaactcgg
aaactgactgatgtggaagcccaagtactaaaccagacgacaagactcgagctgcagctt
ctccaacattctatttctaccaacaaattggaaaagcagattttggatcagaccagtgaa
ataaacaagctacaaaataagaacagcttcctagaacagaaagttctggacatggagggc
aagcacagcgagcagctacagtccatgaaggagcagaaggacgagctccaggtgctggtg
tccaagcagagctctgtcattgacgagctggagaagaagctggtgacagccacggtcaac
aactcgctccttcagaagcagcagcatgacctaatggagaccgtcaacagcttgctgacc
atgatgtcatcacccaactccaagagctcggttgctatccgtaaagaagagcaaaccacc
ttcagagactgtgcggaaatcttcaagtcaggactcaccaccagtggcatctacacactg
accttccccaactccacagaggagatcaaggcctactgtgacatggacgtgggtggagga
gggtggacagtcatccaacaccgagaagatggcagtgtggacttccagaggacgtggaaa
gaatacaaagagggcttcgggagccctctgggagagtactggctgggcaatgagtttgtc
tcccagctgaccggtcagcaccgctacgtgcttaagatccagctgaaggactgggaaggc
aacgaggcgcattcgctgtatgatcacttctacctcgctggtgaagagtccaactacagg
attcaccttacaggactcacggggaccgcgggcaaaataagtagcatcagccaaccagga
agtgattttagcacaaaggattcggacaatgacaaatgcatctgcaagtgttcccagatg
ctctcaggaggctggtggtttgacgcatgtggtccttccaacttgaatggacagtactac
ccacaaaaacagaatacaaataagtttaacggtatcaagtggtactactggaaggggtcc
ggctactcgctcaaggccacaaccatgatgatccggccagcagatttctaa

DBGET integrated database retrieval system