KEGG   Mus musculus (mouse): 11605Help
Entry
11605             CDS       T01002                                 

Gene name
Gla, Ags
Definition
galactosidase, alpha (EC:3.2.1.22)
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
mmu  Mus musculus (mouse)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    11605 (Gla)
  Lipid metabolism
   00561 Glycerolipid metabolism
    11605 (Gla)
   00600 Sphingolipid metabolism
    11605 (Gla)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    11605 (Gla)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    11605 (Gla)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     11605 (Gla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X E-F1; X 56.2 cM
AA seq 421 aa AA seqDB search
MAMKLLSRDTRLVCELALCPLALVFWSILGVRALDNGLARTPTMGWLHWERFMCNLDCQE
EPDACISEQLFMQMAELMVSDGWRDAGYDYLCIDDCWMAPERDSKGRLQADPQRFPSGIK
HLANYVHSKGLKLGIYADVGNKTCAGFPGSFGSYDIDAQTFADWGVDLLKFDGCHCDSVV
SLENGYKYMALALNRTGRSIVYSCEWPLYLRPFHKPNYTDIQYYCNHWRNFDDVYDSWES
IKNILSWTVVYQKEIVEVAGPGSWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSN
DLRQISSQAKALLQNKDVIAINQDPLGKQGYCFRKENHIEVWERPLSNLAWAVAVRNLQE
IGGPCPYTIQISSLGRGLACNPGCIITQLLPEKVHLGFYEWTLTLKTRVNPSGTVLFRLE
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaagcttttgagcagagatacgcggctggtctgtgagcttgcgctttgtccc
ctggctttagttttctggagcattcttggggtcagagcattggacaatggcttggcgcgg
actcctactatgggctggctgcattgggaacgtttcatgtgcaaccttgactgccaagaa
gagcctgatgcctgcataagtgagcaactgttcatgcagatggcagagctcatggtctct
gatggctggcgggatgcaggttatgactatctctgcatagatgactgttggatggctccc
gagagggattcaaagggcaggcttcaggcagatccccaacgctttcctagtgggatcaaa
cacctcgcaaattacgtccacagcaaaggattgaagctagggatttatgcagatgttggg
aataaaacctgtgcaggtttccccgggagttttggatcctatgacattgatgcgcagaca
tttgctgactggggcgtagatctgctaaaatttgatggttgtcactgtgacagtgtagta
tccttggagaatggttataagtacatggccttggccttgaacaggacaggccgaagcatt
gtatactcctgtgagtggccactttatttgagaccctttcataagcccaattatacagat
atccaatattactgcaatcattggagaaattttgatgatgtttatgattcctgggaaagc
ataaagaatatcttgtcttggacagtggtttaccagaaggagattgttgaagtcgctgga
ccaggcagctggaatgacccagacatgttagtgatcggcaactttggcctcagttgggac
cagcaggtgacacagatggccctctgggctatcatggccgctcccctactcatgtccaac
gatctgcgacaaatcagctctcaagccaaagctctgcttcagaataaggatgtaattgcc
atcaaccaagaccccttgggcaagcagggctactgtttcagaaaggaaaaccacattgag
gtttgggaacggccactctccaacctagcctgggctgtggctgtgagaaacctgcaggag
attggtggaccttgtccttataccatccagatttcttccctgggtagaggactagcctgc
aatcctggctgcatcattactcagcttctccccgagaaagtacacctaggcttctatgaa
tggactttgaccttaaaaactcgagtaaacccctcaggcactgttttgtttcggttagaa
agataa

DBGET integrated database retrieval system