KEGG   Mus musculus (mouse): 11605Help
Entry
11605             CDS       T01002                                 

Gene name
Gla, Ags
Definition
(RefSeq) galactosidase, alpha
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu00561  Glycerolipid metabolism
mmu00600  Sphingolipid metabolism
mmu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    11605 (Gla)
  Lipid metabolism
   00561 Glycerolipid metabolism
    11605 (Gla)
   00600 Sphingolipid metabolism
    11605 (Gla)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    11605 (Gla)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    11605 (Gla)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     11605 (Gla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase Chromo
Motif
Other DBs
NCBI-GeneID: 11605
NCBI-ProteinID: NP_038491
MGI: 1347344
Ensembl: ENSMUSG00000031266
Vega: OTTMUSG00000019384
UniProt: Q8BGZ6 Q3UM38
Position
X E3; X 56.2 cM
AA seq 421 aa AA seqDB search
MAMKLLSRDTRLVCELALCPLALVFWSILGVRALDNGLARTPTMGWLHWERFMCNLDCQE
EPDACISEQLFMQMAELMVSDGWRDAGYDYLCIDDCWMAPERDSKGRLQADPQRFPSGIK
HLANYVHSKGLKLGIYADVGNKTCAGFPGSFGSYDIDAQTFADWGVDLLKFDGCHCDSVV
SLENGYKYMALALNRTGRSIVYSCEWPLYLRPFHKPNYTDIQYYCNHWRNFDDVYDSWES
IKNILSWTVVYQKEIVEVAGPGSWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSN
DLRQISSQAKALLQNKDVIAINQDPLGKQGYCFRKENHIEVWERPLSNLAWAVAVRNLQE
IGGPCPYTIQISSLGRGLACNPGCIITQLLPEKVHLGFYEWTLTLKTRVNPSGTVLFRLE
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaagcttttgagcagagatacgcggctggtctgtgagcttgcgctttgtccc
ctggctttagttttctggagcattcttggggtcagagcattggacaatggcttggcgcgg
actcctactatgggctggctgcattgggaacgtttcatgtgcaaccttgactgccaagaa
gagcctgatgcctgcataagtgagcaactgttcatgcagatggcagagctcatggtctct
gatggctggcgggatgcaggttatgactatctctgcatagatgactgttggatggctccc
gagagggattcaaagggcaggcttcaggcagatccccaacgctttcctagtgggatcaaa
cacctcgcaaattacgtccacagcaaaggattgaagctagggatttatgcagatgttggg
aataaaacctgtgcaggtttccccgggagttttggatcctatgacattgatgcgcagaca
tttgctgactggggcgtagatctgctaaaatttgatggttgtcactgtgacagtgtagta
tccttggagaatggttataagtacatggccttggccttgaacaggacaggccgaagcatt
gtatactcctgtgagtggccactttatttgagaccctttcataagcccaattatacagat
atccaatattactgcaatcattggagaaattttgatgatgtttatgattcctgggaaagc
ataaagaatatcttgtcttggacagtggtttaccagaaggagattgttgaagtcgctgga
ccaggcagctggaatgacccagacatgttagtgatcggcaactttggcctcagttgggac
cagcaggtgacacagatggccctctgggctatcatggccgctcccctactcatgtccaac
gatctgcgacaaatcagctctcaagccaaagctctgcttcagaataaggatgtaattgcc
atcaaccaagaccccttgggcaagcagggctactgtttcagaaaggaaaaccacattgag
gtttgggaacggccactctccaacctagcctgggctgtggctgtgagaaacctgcaggag
attggtggaccttgtccttataccatccagatttcttccctgggtagaggactagcctgc
aatcctggctgcatcattactcagcttctccccgagaaagtacacctaggcttctatgaa
tggactttgaccttaaaaactcgagtaaacccctcaggcactgttttgtttcggttagaa
agataa

DBGET integrated database retrieval system