KEGG   Mus musculus (mouse): 11607Help
Entry
11607             CDS       T01002                                 

Gene name
Agtr1a, 1810074K20Rik, AG2S, AI551199, AT1, AT1a, AT2R1, AT2R1A, Agtr-1a, Agtr1, Angtr-1a
Definition
(RefSeq) angiotensin II receptor, type 1a
  KO
K04166  
angiotensin II receptor type 1
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Renin-angiotensin system
Renin secretion
Aldosterone synthesis and secretion
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    11607 (Agtr1a)
   04072 Phospholipase D signaling pathway
    11607 (Agtr1a)
   04022 cGMP - PKG signaling pathway
    11607 (Agtr1a)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11607 (Agtr1a)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    11607 (Agtr1a)
   04614 Renin-angiotensin system
    11607 (Agtr1a)
   04925 Aldosterone synthesis and secretion
    11607 (Agtr1a)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11607 (Agtr1a)
   04270 Vascular smooth muscle contraction
    11607 (Agtr1a)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11607 (Agtr1a)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    11607 (Agtr1a)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    11607 (Agtr1a)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Angiotensin
    11607 (Agtr1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 A3.2; 13 13.19 cM
AA seq 359 aa AA seqDB search
MALNSSTEDGIKRIQDDCPRAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIHRNVYFIENTNITVC
AFHYESRNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCKIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNMSSAAKKPASCSEVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcccttaactcttctactgaagatggcatcaaaagaattcaagatgactgccccagg
gctggcaggcacagttacatatttgtcatgatccctactctctacagcatcatctttgtg
gtgggaatatttggaaacagcttggtggtgatcgtcatctacttttacatgaagctgaag
actgtggccagtgtctttcttctaaatctcgccctggctgacttatgctttttgctgact
ttgcccctgtgggctgtctataccgctatggaataccgctggcccttcggcaatcaccta
tgtaagatcgcttcggccagcgtcagtttcaacctctacgccagcgtgttcctgctcacg
tgtctcagcatcgatcgctacctggccattgtccacccgatgaagtctcgcctccgccgc
acgatgctggtggccaaagtcacctgcatcatcatctggctgatggctggcttggccagt
ttgccagccgtcatccaccgaaatgtgtatttcattgagaacaccaatatcactgtttgc
gcttttcattacgagtcccggaattcaacgctccccataggactgggcctaaccaagaac
atcctgggcttcctgttccctttcctaatcattcttaccagctatactcttatatggaaa
gctctaaagaaggcttatgaaattcagaagaacaagccaagaaatgatgacatctttagg
ataattatggcgattgtgcttttcttcttcttctcctgggtcccccaccaaatattcaca
ttcctggatgtgctgattcagctgggcgtcatccatgactgtaaaattgccgacatcgtg
gacactgccatgcccataaccatctgcatagcgtattttaacaactgcctgaaccctctg
ttttacggctttctggggaaaaaatttaaaaagtatttcctccagctcctgaaatatatt
cccccaaaggccaagtcgcactcaagcctgtctacgaaaatgagcacgctctcctaccgc
ccctcagataacatgagctcagccgccaaaaagcctgcgtcttgttctgaggtggagtga

DBGET integrated database retrieval system