KEGG   Mus musculus (mouse): 11608Help
Entry
11608             CDS       T01002                                 

Gene name
Agtr1b, AT1B, AT2R1B, Agtr-1b, Angtr-1b
Definition
(RefSeq) angiotensin II receptor, type 1b
  KO
K04166  angiotensin II receptor type 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing's syndrome
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    11608 (Agtr1b)
   04020 Calcium signaling pathway
    11608 (Agtr1b)
   04072 Phospholipase D signaling pathway
    11608 (Agtr1b)
   04022 cGMP - PKG signaling pathway
    11608 (Agtr1b)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11608 (Agtr1b)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    11608 (Agtr1b)
   04614 Renin-angiotensin system
    11608 (Agtr1b)
   04925 Aldosterone synthesis and secretion
    11608 (Agtr1b)
   04927 Cortisol synthesis and secretion
    11608 (Agtr1b)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11608 (Agtr1b)
   04270 Vascular smooth muscle contraction
    11608 (Agtr1b)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11608 (Agtr1b)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    11608 (Agtr1b)
   04934 Cushing's syndrome
    11608 (Agtr1b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    11608 (Agtr1b)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Angiotensin
    11608 (Agtr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 11608
NCBI-ProteinID: NP_780295
MGI: 87965
Ensembl: ENSMUSG00000054988
Vega: OTTMUSG00000034694
UniProt: P29755 Q32MF7 Q8BU69
Position
3 A2; 3 6.37 cM
AA seq 359 aa AA seqDB search
MILNSSIEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYQWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIHRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFVIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFSFLDVLIQLGVIHDCEIADVVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKRYFLQLLKYIPPKARSHAGLSTKMSTLSYRPSDNMSSSARKSAYCFEVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatccttaactcttctattgaagatggaattaaaagaatccaagatgactgccccaag
gctggcaggcacaattacatatttgtcatgatccctactctctacagcatcatctttgtg
gtgggaatatttggaaacagtttggtggtaattgtcatttacttttacatgaagctaaag
actgtggccagtgttttccttctgaatcttgccctggctgatttatgctttttgttgact
ttgcctctgtgggcagtttataccgctatggaataccagtggcccttcggcaatcaccta
tgtaagatcgcttcggccagcgtcagtttcaacctctacgccagtgtgttcctgctcacg
tgtctcagcatcgatcgctacctagccattgtccacccaatgaagtctcgcctccgacgc
acaatgctggtcgccaaagtcacctgcatcatcatctggctgatggctggcttggctagt
ttgccggccgtcatccaccgaaatgtgtatttcatcgagaacaccaatatcacagtttgt
gcttttcattatgaatctcagaactcaacactccccattggactgggtctgaccaagaac
attctgggcttcgtgttccctttcgttattattctcaccagctatactctgatttggaaa
gccctaaagaaggcttacaaaattcagaagaatacgccaaggaatgatgacatctttagg
ataatcatggcgattgtgcttttcttcttcttttcctgggttccccaccaaatattcagt
tttctggatgtgctcattcagctgggcgtcatccatgactgtgaaattgcggacgtagtg
gacactgctatgcccatcaccatctgcatagcttattttaacaattgcctgaaccctctg
ttttatggctttctggggaaaaaatttaaaagatatttcctccagcttctgaaatatatt
cccccaaaggccaggtcgcatgcagggttatcaacaaaaatgagtactctttcctaccgc
ccttcagataacatgagctcgtctgccaggaagtctgcgtattgttttgaagtggagtga

DBGET integrated database retrieval system