KEGG   Mus musculus (mouse): 11632Help
Entry
11632             CDS       T01002                                 

Gene name
Aip, AA408703, AW476050, Ara9, D19Bwg1412e, Fkbp16, Xap2
Definition
(RefSeq) aryl-hydrocarbon receptor-interacting protein
  KO
K17767  
AH receptor-interacting protein
Organism
mmu  Mus musculus (mouse)
Brite
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    11632 (Aip)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 A; 19 3.82 cM
AA seq 330 aa AA seqDB search
MADLIARLREDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGKPM
ELIVGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAEGKDPLEGQRH
CCGIAQMHEHSSLGHADLDALQQNPQPLIFHIEMLKVESPGTYQQDPWAMTDEEKAKAVP
VIHQEGNRLYREGQVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDLQITPLLLNYCQC
KLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAP
VVSRELRALETRIRQKDEEDKARFRGIFSH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcggatctcatcgcaagacttcgagaggacgggatccaaaagcgtgtgatacaggag
ggccgaggagagttgccggactttcaggatggcactaaggccacgttccactttcggacg
ctgcacagtgacaatgaaggctccgttatagatgacagccgaacacgaggcaagcccatg
gagctcatcgttggcaagaagttcaagttgcctgtgtgggagaccatcgtgtgcaccatg
cgtgagggggagattgcccagttcctctgtgacatcaagcacgtagtcctgtatcctcta
gtggccaagagcctccgcaacatcgccgagggcaaggaccccctggagggacagcggcat
tgctgtgggatcgctcagatgcatgaacacagctccctgggtcatgcggacctggatgcc
ctgcagcagaacccacagcctctcatcttccacatcgagatgctgaaggtagagagtcct
ggcacctatcaacaggacccatgggcgatgacagatgaggagaaagcaaaggcagtacca
gtcatccaccaagagggcaaccggttgtaccgtgagggccaggtgaaagaggctgctgcc
aagtactatgacgccatcgcctgcctcaagaatctgcagatgaaggagcagcctggctca
cctgactggatccagttggacctgcagatcacaccactgctactcaactattgccagtgc
aagctggtggctcaggagtattatgaagtgttggatcactgctcctccatcctcaacaag
tatgatgacaatgtcaaggcttacttcaagaggggtaaggcccatgctgccgtgtggaat
gcccaggaggcccaggctgactttgccaaggtgttggagctagaccctgccctggcgcct
gtggtaagcagagagctgcgggccctggagacacggatccggcagaaggatgaggaggac
aaagctcgcttccggggcatcttttcccactga

DBGET integrated database retrieval system