KEGG   Mus musculus (mouse): 11639Help
Entry
11639             CDS       T01002                                 

Gene name
Ak4, AK_4, Ak-3, Ak-4, Ak3, Ak3l1, D4Ertd274e
Definition
(RefSeq) adenylate kinase 4 (EC:2.7.4.10 2.7.4.6)
  KO
K00939  
adenylate kinase [EC:2.7.4.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    11639 (Ak4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     11639 (Ak4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11639 (Ak4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C6; 4 46.84 cM
AA seq 223 aa AA seqDB search
MASKLLRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEK
GLLVPDHVITRLMMSELETRSAQHWLLDGFPRTLVQAEALDGICDVDLVISLNIPFETLK
DRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKP
VIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQSKEAY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaactcctgcgcgcggtcatcctcgggccgcccggctctggcaagggcacc
gtttgcgaaaggatcgcccagaactttggcctccagcatctctccagcggccacttgttg
cgggagaacctcaagaccggcacggaagttggtgacgtggcaaaacagtacctagaaaaa
ggtcttttggttccagatcacgtgatcacacgcctaatgatgtcagaactggagactcgg
agtgcccagcactggctgttagatggattcccgaggacattagtacaggcagaagccctg
gacggaatctgtgatgtggacctagtaatcagtttgaatattccttttgagacacttaaa
gatcgtctgagccgacggtggattcacccttctagcgggagggtctataacctggacttc
aacccacctcaagtgcaggggattgatgacatcactggtgagccacttgtccaacaggaa
gatgataaacctgaagcagttgctgccaggctaagacggtacaaggatgcggcaaaacca
gtcatcgaactgtacaagagccgtggagtgctccaccagttttctgggacggagactaac
agaatctggccttatgtttacacacttttctccaacaagatcacacctattcaatccaaa
gaagcctactga

DBGET integrated database retrieval system