KEGG   Mus musculus (mouse): 11650Help
Entry
11650             CDS       T01002                                 

Gene name
Alppl2, Akp5, C77216, D1Ertd816e, EAP
Definition
alkaline phosphatase, placental-like 2 (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
1 D; 1 44.05 cM
AA seq 529 aa AA seqDB search
MWGACLLLLGLSLQVCPSVIPVEEENPAFWNRKAAEALDAAKKLKPIQTSAKNLVILMGD
GMGVSTVTATRILKGQQQGHLGPETQLAMDRFPHMALSKTYNTDKQIPDSAGTGTAFLCG
VKTNMKVIGLSAAARFNQCNTTWGNEVVSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAH
TVNRGWYSDAQMPASALQDGCKDISTQLISNMDIDVILGGGRKFMFPKGTPDQEYPTDTK
QAGTRLDGRNLVQEWLAKHQGARYVWNRSELIQASLNRSVTHLMGLFEPNDMKYEIHRDP
AQDPSLAEMTEVAVRMLSRNPKGFYLFVEGGRIDHGHHETVAYRALTEAVMFDSAVDKAD
KLTSEQDTMILVTADHSHVFSFGGYTQRGASIFGLAPFKAEDGKSFTSILYGNGPGYKLH
NGARADVTEEESSNPTYQQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVM
AFAACLEPYTDCGLASPAGQSSAVSPGYMSTLLCLLAGKMLMLMAAAEP
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtggggagcctgcttgctgctgctgggcctcagcctacaggtgtgcccgagcgtcatc
ccagtggaggaggagaatccagccttctggaaccgaaaggcagccgaggccctggatgct
gccaagaagctgaagcccattcagacatcagctaagaacctcgttatcctcatgggagat
gggatgggggtgtctacagtaaccgctacccggatcctaaaggggcagcagcaaggccat
ctgggacctgagacacagctagctatggatcgctttccacacatggctctgtccaagaca
tacaacacagacaagcagatcccggacagcgcaggcacaggtacagcctttctctgcggg
gtcaaaaccaacatgaaggtcattggcttgagtgcagctgcacgcttcaaccagtgcaac
acgacatggggtaacgaggtcgtctcggtgatgcaccgtgctaagaaagcaggaaagtct
gtgggagtggtgaccaccacgtcggtgcagcatgcttctccggccggcacctacgcgcac
actgtgaaccgtggttggtactcggatgcacaaatgcctgcctcagcgctacaggatggc
tgcaaagacatctctactcagctcatctccaacatggacattgatgtgatcctcggtggt
ggccgcaagttcatgtttcccaaggggacaccagaccaggaatatccaactgacaccaag
caggctggaaccaggctggatggacgcaacctagttcaagagtggctggcaaagcaccag
ggagcccggtatgtttggaaccgctcagagctcattcaggcatccctgaaccgatctgtg
acacacctcatgggcctctttgagcctaacgacatgaaatatgaaatccaccgagaccct
gctcaggacccttccctggccgagatgacggaggtggctgtgcgcatgctcagcaggaac
cccaaaggcttctatctctttgtggaagggggtcgcatcgaccatggccaccatgaaact
gtagcctatcgtgccctgactgaggctgtcatgttcgactcagctgttgacaaggcagac
aagctcaccagtgagcaggacacgatgatccttgtcactgccgaccactctcacgtcttc
tcttttggtggttacacacagagaggggcttccatctttggactggctcccttcaaggct
gaggatggcaaatcctttacctcgatactatacggcaacggtcctggttacaagctccat
aatggcgcccgggctgatgtcactgaggaagagagcagcaaccccacgtaccagcagcag
gctgctgtacccctgtcgtcagagacccacagcggggaggacgtggcaatattcgcgcgt
ggcccacaggcgcacctggtgcacggagttcaggagcagaactacatcgcgcacgtcatg
gccttcgcagcctgcctggagccctacactgactgcggcctggcatcccctgctggccag
agcagtgcagtgagcccgggctacatgtccaccttgctgtgcctgttggcagggaaaatg
ttgatgctgatggcggcggctgaaccctga

DBGET integrated database retrieval system