KEGG   Mus musculus (mouse): 11652Help
Entry
11652             CDS       T01002                                 

Gene name
Akt2, 2410016A19Rik, AW554154, PKB, PKBbeta
Definition
(RefSeq) thymoma viral proto-oncogene 2 (EC:2.7.11.1)
  KO
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Carbohydrate digestion and absorption
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    11652 (Akt2)
   04015 Rap1 signaling pathway
    11652 (Akt2)
   04010 MAPK signaling pathway
    11652 (Akt2)
   04012 ErbB signaling pathway
    11652 (Akt2)
   04370 VEGF signaling pathway
    11652 (Akt2)
   04630 Jak-STAT signaling pathway
    11652 (Akt2)
   04668 TNF signaling pathway
    11652 (Akt2)
   04066 HIF-1 signaling pathway
    11652 (Akt2)
   04068 FoxO signaling pathway
    11652 (Akt2)
   04072 Phospholipase D signaling pathway
    11652 (Akt2)
   04071 Sphingolipid signaling pathway
    11652 (Akt2)
   04024 cAMP signaling pathway
    11652 (Akt2)
   04022 cGMP - PKG signaling pathway
    11652 (Akt2)
   04151 PI3K-Akt signaling pathway
    11652 (Akt2)
   04152 AMPK signaling pathway
    11652 (Akt2)
   04150 mTOR signaling pathway
    11652 (Akt2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    11652 (Akt2)
  Cellular commiunity
   04510 Focal adhesion
    11652 (Akt2)
   04530 Tight junction
    11652 (Akt2)
   04550 Signaling pathways regulating pluripotency of stem cells
    11652 (Akt2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    11652 (Akt2)
   04620 Toll-like receptor signaling pathway
    11652 (Akt2)
   04660 T cell receptor signaling pathway
    11652 (Akt2)
   04662 B cell receptor signaling pathway
    11652 (Akt2)
   04664 Fc epsilon RI signaling pathway
    11652 (Akt2)
   04666 Fc gamma R-mediated phagocytosis
    11652 (Akt2)
   04062 Chemokine signaling pathway
    11652 (Akt2)
  Endocrine system
   04910 Insulin signaling pathway
    11652 (Akt2)
   04922 Glucagon signaling pathway
    11652 (Akt2)
   04923 Regulation of lipolysis in adipocyte
    11652 (Akt2)
   04920 Adipocytokine signaling pathway
    11652 (Akt2)
   04915 Estrogen signaling pathway
    11652 (Akt2)
   04914 Progesterone-mediated oocyte maturation
    11652 (Akt2)
   04917 Prolactin signaling pathway
    11652 (Akt2)
   04919 Thyroid hormone signaling pathway
    11652 (Akt2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11652 (Akt2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    11652 (Akt2)
  Nervous system
   04725 Cholinergic synapse
    11652 (Akt2)
   04728 Dopaminergic synapse
    11652 (Akt2)
   04722 Neurotrophin signaling pathway
    11652 (Akt2)
  Development
   04380 Osteoclast differentiation
    11652 (Akt2)
  Aging
   04211 Longevity regulating pathway - mammal
    11652 (Akt2)
   04213 Longevity regulating pathway - multiple species
    11652 (Akt2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11652 (Akt2)
   05230 Central carbon metabolism in cancer
    11652 (Akt2)
   05231 Choline metabolism in cancer
    11652 (Akt2)
   05205 Proteoglycans in cancer
    11652 (Akt2)
   05210 Colorectal cancer
    11652 (Akt2)
   05212 Pancreatic cancer
    11652 (Akt2)
   05214 Glioma
    11652 (Akt2)
   05221 Acute myeloid leukemia
    11652 (Akt2)
   05220 Chronic myeloid leukemia
    11652 (Akt2)
   05218 Melanoma
    11652 (Akt2)
   05211 Renal cell carcinoma
    11652 (Akt2)
   05215 Prostate cancer
    11652 (Akt2)
   05213 Endometrial cancer
    11652 (Akt2)
   05222 Small cell lung cancer
    11652 (Akt2)
   05223 Non-small cell lung cancer
    11652 (Akt2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    11652 (Akt2)
   04931 Insulin resistance
    11652 (Akt2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    11652 (Akt2)
  Infectious diseases
   05152 Tuberculosis
    11652 (Akt2)
   05166 HTLV-I infection
    11652 (Akt2)
   05162 Measles
    11652 (Akt2)
   05164 Influenza A
    11652 (Akt2)
   05161 Hepatitis B
    11652 (Akt2)
   05160 Hepatitis C
    11652 (Akt2)
   05169 Epstein-Barr virus infection
    11652 (Akt2)
   05145 Toxoplasmosis
    11652 (Akt2)
   05142 Chagas disease (American trypanosomiasis)
    11652 (Akt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11652 (Akt2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  AKT/PKB family
   11652 (Akt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 15.94 cM; 7 B1
AA seq 481 aa AA seqDB search
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDAM
DYKCGSPSDSSTSEMMEVAVNKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLDPLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggtatctgtcatcaaagaaggctggctccacaaacgtggtgaatacatcaag
acctggaggccacggtacttccttctgaagagtgatggatctttcattgggtataaggag
aggcccgaggcccctgaccagaccttaccccccctgaacaatttctctgtagcagaatgc
cagctgatgaagactgagaggccacgacccaacacctttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccatgtagactctccagatgagagggaagagtggatg
cgggctatccagatggtcgccaacagtctgaagcagcggggcccaggtgaggacgccatg
gattacaagtgtggctcccccagtgactcttccacatctgagatgatggaggtagctgtc
aacaaggcacgggccaaagtgaccatgaatgacttcgattatctcaaactcctcggcaag
ggcaccttcggcaaggtcattctggttcgagagaaggccactggccgctattatgccatg
aagatcctgcgcaaggaggtcatcattgcaaaggatgaagtcgcccacacagtcacagag
agccgggttctgcagaataccaggcaccccttccttacagccctcaagtatgccttccag
acccatgaccgcctatgctttgtgatggagtatgccaacgggggtgagctgtttttccac
ctctctcgggagcgagtcttcacggaggatcgggcgcgcttttatggagcagagattgtg
tcagctctggagtatttgcactcgagagatgtggtgtaccgtgacatcaagctggaaaac
cttatgttggacaaagatggccacatcaagatcactgactttggcttgtgcaaagagggc
atcagtgatggagccaccatgaaaaccttctgtggtaccccggagtacttggcgcctgag
gtgctagaggacaatgactatgggcgagcagtggactggtgggggctgggtgtggtcatg
tatgagatgatgtgtggccgcctgccattctacaaccaggaccacgagcgcctctttgag
ctcattcttatggaggagatccgcttcccgcgcacactcgggccagaggccaagtccctg
ctggctggactgctgaagaaggacccaaagcagaggctcggcggaggtcccagtgatgcg
aaggaggtcatggagcatagattcttcctcagcatcaactggcaggacgtggtacagaaa
aagctcctgccacccttcaaacctcaggtcacttcagaagtggacacaaggtactttgat
gacgagttcaccgcccagtccatcacaatcacacccccagaccgatatgacagcctggac
ccgctggaactggaccagcggacgcacttcccccagttctcctactcagccagcatccga
gagtga

DBGET integrated database retrieval system