KEGG   Mus musculus (mouse): 11682Help
Entry
11682             CDS       T01002                                 

Gene name
Alk, CD246, Tcrz
Definition
anaplastic lymphoma kinase (EC:2.7.10.1)
Orthology
K05119  
anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Non-small cell lung cancer
Class
Human Diseases; Cancers; Non-small cell lung cancer [PATH:mmu05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 E1.3; 17 43.77 cM
AA seq 1621 aa AA seqDB search
MGAAGFLWLLPPLLLAAASYSGAATDQRAGSPASGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPQPRSPSEPEAGGLEARGSLALDCEPLLRLLGPLPGISWADGASSPS
PEAGPTLSRVLKGGSVRKLRRAKQLVLELGEETILEGCIGPPEEVAAVGILQFNLSELFS
WWILHGEGRLRIRLMPEKKASEVGREGRLSSAIRASQPRLLFQIFGTGHSSMESPSETPS
PPGTFMWNLTWTMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHNHGNQSWSWRHVPSE
EASRMNLLDGPEAEHSQEMPRGSFLLLNTSADSKHTILSPWMRSSSDHCTLAVSVHRHLQ
PSGRYVAQLLPHNEAGREILLVPTPGKHGWTVLQGRVGRPANPFRVALEYISSGNRSLSA
VDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDEGQLCSKLPA
GFYCNFENGFCGWTQSPLSPHMPRWQVRTLRDAHSQGHQGRALLLSTTDILASEGATVTS
ATFPAPMKNSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQSRTVWHVATDEGLSLWQHT
VLSLLDVTDRFWLQIVTWWGPGSRATVGFDNISISLDCYLTISGEEKMSLNSVPKSRNLF
EKNPNKESKSWANISGPTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVVVGS
EGPLKGVQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKGDTLYILVG
QQGEDACPRANQLIQKVCVGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPV
PLIIAAGGGGRAYGAKTETFHPERLESNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSL
LEGAAGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGV
SFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAD
DGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSP
EYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVS
GMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILL
ELMAGGDLKSFLRETRPRPNQPTSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCL
LTCPGAGRIAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFG
VLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNF
AIILERIEYCTQDPDVINTALPIEYGPVVEEEEKVPMRPKDPEGMPPLLVSPQPAKHEEA
SAAPQPAALTAPGPSVKKPPGAGAGAGAGAGAGPVPRGAADRGHVNMAFSQPNPPPELHK
GPGSRNKPTSLWNPTYGSWFTEKPAKKTHPPPGAEPQARAGAAEGGWTGPGAGPRRAEAA
LLLEPSALSATMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATAAPGDTMLKSKNKVTQPG
P
NT seq 4866 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctgggttcctgtggctgctgcctccactgcttttggcagcagcctcgtac
tccggagctgcaaccgatcagcgcgcgggttccccagcctcagggcctcctctgcagccc
cgggagccgctcagttattcgcgcctgcagaggaagagtctggcagtggacttcgttgta
ccctcgctcttccgcgtctatgcccgagacctgctgctaccgcagccacggtccccctcg
gagcccgaggctggcgggctggaggcgcggggatcactggccctggattgtgagcctctg
ctcaggctgctggggccactgcctggaatctcctgggcagatggagccagttctcctagt
cccgaggcgggtccgacgctgtccagggtgctgaagggaggctcggtgcgcaagctcagg
cgtgccaaacagctggtgctggagctgggcgaggagacgattcttgaaggctgtattggt
cccccagaggaggtagcggctgtggggatactccagttcaacctcagcgagctgttcagc
tggtggattctccacggcgaagggaggctgaggatccgcctgatgcctgagaagaaggca
tcggaagtgggcagggagggaaggctatccagtgcgatccgagcctcccagccccgcctt
ctcttccagatcttcgggacgggacacagctccatggagtcaccctcagaaacgccttct
cctcctggtaccttcatgtggaatctgacctggacgatgaaagactccttccctttcctt
tcccaccgcagtcgatatggtctggagtgcagctttgacttcccctgtgagctggaatat
tctcctcccctgcacaaccacgggaatcagagctggtcctggcgccatgtgccctccgag
gaggcctcgaggatgaacttgctggatgggccagaggcagagcattctcaagagatgccc
agaggctccttcctcctcctgaacacctctgcagattccaagcataccattctgagccca
tggatgaggagcagtagtgatcactgcacactggctgtctccgtgcacagacatctacag
ccttcggggagatatgttgcccagctcctaccccacaacgaagctggaagagagattctt
ttggtgcccaccccagggaagcatggctggacagtgctgcaggggagagtcgggcgccca
gcaaacccatttcgagtggctctggaatacatctccagtggcaaccggagcttgtcggcg
gtggatttctttgccctgaagaactgcagtgaagggacatccccaggctccaagatggca
ttgcagagttccttcacttgttggaatgggaccgtcctccagctcgggcaagcctgtgat
ttccaccaggactgtgcccaaggagaagatgagggccagctgtgcagtaaacttcctgct
ggattttactgtaactttgaaaatggcttctgtggctggacccaaagtccactctcaccc
catatgccccggtggcaagtgaggaccctaagagatgcccattcccagggccaccaaggc
cgtgccctgttgctcagcaccactgacatcctcgcttctgaaggtgcaacagtgaccagt
gccaccttccctgcaccaatgaaaaattctccttgtgagctccgcatgtcctggctcatc
cgcggggttttgagaggaaacgtatctctggtgctggtggagaacaaaaccggaaaggag
caaagccggactgtctggcatgtcgccactgacgaaggcttaagcctgtggcagcataca
gtgctgtccctcctcgatgtgactgacaggttctggctgcagatagtcacatggtggggt
ccaggatccagggcaaccgtgggatttgacaacatttccatcagcctcgactgctacctt
accatcagtggagaggagaaaatgtccctgaattcagtacccaaatctagaaatctgttt
gagaaaaacccaaacaaggagtcaaaatcctgggcaaacatatcaggaccaactcccatc
ttcgaccctacagttcactggctgttcaccacgtgtggggccagtggacctcatggcccc
acccaggcacagtgcaacaacgcctaccagaattccaacttgagcgtggtggtgggaagt
gaagggcccttgaagggagtccagatttggaaagtgccagctactgacacctacagtatc
tcgggctacggagcagctggcgggaaaggtgggaaaaacaccatgatgcggtcccatggc
gtgtctgtcctgggcatcttcaatctggagaaaggtgacacactctacatccttgtcggt
cagcaaggggaggatgcctgtcccagggcaaaccaactaatccagaaagtctgtgtgggt
gagaacaatgtcatagaagaagagatccgagtgaacagaagcgtgcacgagtgggcagga
ggaggaggaggtgggggtggagccacctacgtgtttaagatgaaagatggcgtgcctgta
cccctgatcattgcagctggtggtggtggcagggcctatggggccaagacagaaacgttc
cacccagagagactggagagtaactcctcggttctagggctgaacggcaattccggagcc
gcaggtggtggaggcggctggaatgataacacttccttgctctgggccggaaagtctttg
ctggagggtgccgccggaggacattcctgcccccaggccatgaagaagtgggggtgggag
acaagagggggtttcggagggggtggaggggggtgctcctcaggtggaggaggcggagga
tatataggtggcaacgcagcatcaaacaatgaccccgaaatggatggggaagatggggtt
tccttcatcagtccattgggtatcctgtacaccccggccttaaaagtgatggagggccac
ggggaagtgaatatcaagcattatctaaactgcagtcactgcgaggtagacgaatgtcac
atggaccccgagagccacaaagtcatctgcttctgtgatcatgggaccgtgctggctgat
gatggtgtctcctgcattgtgtcacccaccccggagccccacctgccgctctcattgatc
ctctccgtcgtgacctctgccctggtggctgcccttgttctggcattctccggcatcatg
attgtgtaccgtcggaagcaccaggagttgcaggctatgcagatggaactgcagagcccc
gagtataagctgagcaagctacggacctcgaccatcatgaccgactacaaccccaactac
tgcttcgctggcaagacttcctccatcagtgacctgaaagaagtgccacggaaaaacatc
acactcatccggggcctaggccatggcgcatttggggaggtgtatgaaggccaggtgtct
ggaatgcccaatgacccaagccctctacaagtggctgtaaagacgctgccagaagtgtgt
tcagaacaagatgagctggactttctcatggaagctctgatcatcagcaaattcaaccac
cagaatattgttcgctgcatcggggtgagtctacaagccctgccccgcttcatcctgctg
gaactcatggctggcggagacctcaagtccttcctcagggagacacgccctcgcccgaac
caacccacctccctggccatgctggaccttctgcatgtggctcgggacattgcctgtggc
tgtcagtacctagaggagaatcactttatccaccgggatattgctgctagaaactgtctg
ttgacctgcccaggagctggaagaatagcaaagattggagactttgggatggcccgagat
atctacagggccagctactaccgaaagggaggctgcgccatgctgccggtcaagtggatg
ccccctgaagccttcatggaagggatatttacctctaaaacagacacatggtcttttgga
gtgttgctatgggaaatattttctcttggatatatgccgtaccccagcaagagcaaccag
gaagttctggagtttgtcaccagcggaggacggatggacccgcctaagaactgccccggg
cctgtataccggataatgacgcagtgctggcagcatcagcctgaagacagacccaacttc
gccatcattttggagaggatcgaatactgcacccaggaccccgatgtgatcaacacagct
ctgcccatcgaatacggtccagtagtagaagaggaggagaaagtgcccatgcgccccaaa
gaccccgaggggatgccacctttgctggtgtctccccagcctgcgaagcacgaggaggcg
tccgcagctccccagcccgcagccctgacggcaccaggcccatcggtgaagaagcccccg
ggtgcgggtgcgggcgcgggcgcgggtgcgggtgccggcccggtgccccgaggtgcggcc
gatcggggccacgtgaacatggctttctctcagcccaaccctcccccggagctgcacaaa
ggcccgggatccagaaacaagccgaccagcctgtggaaccccacctacggctcgtggttc
accgagaagcctgccaaaaagacccatcctccgccaggcgccgagccgcaggcgcgggca
ggagcggccgagggtggctggaccgggccgggcgcggggccccgcagagccgaggcagcg
ctgctgctagagccatcggcgctgagcgccaccatgaaggaggtgccgctgttcaggctg
cgccacttcccctgcggcaatgtcaactatggttaccagcaacagggtctccccttggaa
gccacagccgcgccaggggacaccatgctgaaaagcaagaataaggtcacccagccgggg
ccctga

DBGET integrated database retrieval system