KEGG   Mus musculus (mouse): 11684Help
Entry
11684             CDS       T01002                                 

Gene name
Alox12, 9930022G08Rik, Alox12p, P-12LO
Definition
(RefSeq) arachidonate 12-lipoxygenase
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    11684 (Alox12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    11684 (Alox12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    11684 (Alox12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    11684 (Alox12)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     11684 (Alox12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B3; 11 42.99 cM
AA seq 663 aa AA seqDB search
MGRYRVRVVTGAWLFSGSLNLVRLWLVGEHREAKLELQLRPARGKEEEFDFDVPEDLGPL
QFVKLHKQHTVVDDAWFCNLITVQGPGTSAEAVFPCYRWVQGEGILSLPEGTARLAGDNA
LDVFQKYREKELKERQQTYCWATWKEGLPQTIAADCKDDLPPNMRFHEEKRLDFEWTLKA
GVLEMGLKRVYTLLRSWNHLEDFDQIFWGQKSALAEKVHQCWQEDELFGYQFLNGANPML
LRRSTSLPSRLVLPSGMEELQAQLEKELKNGSLFEADFILLDGIPANVIRGEPQYLAAPL
VMLRMDPGGKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFH
LLNTHLVAEVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRSRTQLISDGGIFDQVVST
GGGGHVQLLTRAVAQLTYHSLCPPDDLANRGLLRIPSALYARDALQLWEVTARYVKGMVH
LFYQSDDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQH
AAINQGQLDWYGWVPNAPCTMRMPPPTSKDDVTMETVMGSLPDVQKACLQMTITWHLGRL
QPDMVPLGHHTEKYFSDPRTKAVLSQFQADLDNLEKEITARNEQLDLPYEYLKPSRIENS
ITI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcgtccgtgtggtcactggggcctggctcttctccggatccctcaac
ctagtgcgtttgtggctggttggggagcaccgggaggcgaaactggagctgcaactgcgg
ccagcgcggggcaaggaggaggagtttgacttcgacgttcccgaggacttggggccactg
cagtttgtgaaactgcacaaacagcacacagttgtggatgacgcctggttctgcaacctc
atcacagttcaggggccggggacaagtgcagaggccgtgtttccctgctaccgctgggtg
cagggagagggaatcctgagcctcccggaggggacagcccgcctggcaggagacaatgcc
ttagatgtcttccagaagtatcgagaaaaggaactgaaggaaagacaacagacctactgc
tgggccacctggaaagaaggcttacctcagacaatagcagcggactgtaaggatgacctt
cctccaaatatgagattccatgaggagaagagactggactttgaatggacgttgaaggcg
ggggttctggaaatgggcctcaaacgtgtttataccctcctgagaagctggaaccatctg
gaagactttgatcagatcttctggggccagaagagtgccttggccgagaaggttcaccag
tgttggcaggaagatgaactctttggctaccagttcctcaatggcgccaaccccatgctt
ttgagacgctccacctctctgccctccagactggtactgccctctgggatggaggagctt
caagctcagttggagaaagaactcaagaatggatccctgtttgaagctgactttatcctg
ctggatggaattccagctaatgtgatccgaggagaaccacagtacctggctgcccctctt
gtcatgctgaggatggaccccggtgggaagctgctacccatggctatccagattcagccc
cctaaccccagctccccagctccaacactgttcctgccctcggatcctccacttgcctgg
ctcttggctaagatctgggtccgaaattcagatttccaactgcaggagctccaattccat
ttgctgaacacccatctggtggctgaggtcatcgctgttgccaccatgagatgcctccca
ggactgcaccctatcttcaagctcctcgttccacacatccgttacactatggaaattaac
acgcgaagccggacccagctcatctcagatggaggaatatttgatcaggtagtgagcaca
ggtggaggcggccatgttcagttgcttactcgggcagtggctcagctgacttaccactcc
ctctgtcctcctgatgatctggctaaccgaggcctgctgagaatcccaagtgctctctat
gctcgggatgctttacagctctgggaagtcactgccaggtatgtgaaggggatggtccat
ctcttctaccagagtgatgatattgtgaggggagacccagagctgcaggcctggtgtcgg
gagatcactgaagtggggctgtgccatgcccaggacagaggattccctgtctccttccag
tcccgggctcagctctgccatttcctcaccatgtgtgttttcacatgcactgcccagcat
gctgccatcaaccagggccagctggactggtatggttgggtacctaatgctccatgcaca
atgaggatgcctccgcccaccagcaaggacgacgtgacgatggagaccgtgatggggtcg
ctacctgatgtgcagaaggcctgtcttcagatgactatcacatggcacctgggtcgcctg
cagccagacatggtacctctaggacaccacacagaaaaatatttctcagacccaaggacc
aaagctgtgctcagccaatttcaagcagatttggacaatttggagaaagagattacagcc
cggaatgagcaacttgacctgccttatgaatacctcaagcccagccgcatagagaacagt
atcaccatctga

DBGET integrated database retrieval system