KEGG   Mus musculus (mouse): 11684Help
Entry
11684             CDS       T01002                                 

Gene name
Alox12, 9930022G08Rik, Alox12p, P-12LO
Definition
arachidonate 12-lipoxygenase (EC:1.13.11.31)
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmu00590]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mmu04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:mmu04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B3; 11 42.99 cM
AA seq 663 aa AA seqDB search
MGRYRVRVVTGAWLFSGSLNLVRLWLVGEHREAKLELQLRPARGKEEEFDFDVPEDLGPL
QFVKLHKQHTVVDDAWFCNLITVQGPGTSAEAVFPCYRWVQGEGILSLPEGTARLAGDNA
LDVFQKYREKELKERQQTYCWATWKEGLPQTIAADCKDDLPPNMRFHEEKRLDFEWTLKA
GVLEMGLKRVYTLLRSWNHLEDFDQIFWGQKSALAEKVHQCWQEDELFGYQFLNGANPML
LRRSTSLPSRLVLPSGMEELQAQLEKELKNGSLFEADFILLDGIPANVIRGEPQYLAAPL
VMLRMDPGGKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFH
LLNTHLVAEVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRSRTQLISDGGIFDQVVST
GGGGHVQLLTRAVAQLTYHSLCPPDDLANRGLLRIPSALYARDALQLWEVTARYVKGMVH
LFYQSDDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQH
AAINQGQLDWYGWVPNAPCTMRMPPPTSKDDVTMETVMGSLPDVQKACLQMTITWHLGRL
QPDMVPLGHHTEKYFSDPRTKAVLSQFQADLDNLEKEITARNEQLDLPYEYLKPSRIENS
ITI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcgtccgtgtggtcactggggcctggctcttctccggatccctcaac
ctagtgcgtttgtggctggttggggagcaccgggaggcgaaactggagctgcaactgcgg
ccagcgcggggcaaggaggaggagtttgacttcgacgttcccgaggacttggggccactg
cagtttgtgaaactgcacaaacagcacacagttgtggatgacgcctggttctgcaacctc
atcacagttcaggggccggggacaagtgcagaggccgtgtttccctgctaccgctgggtg
cagggagagggaatcctgagcctcccggaggggacagcccgcctggcaggagacaatgcc
ttagatgtcttccagaagtatcgagaaaaggaactgaaggaaagacaacagacctactgc
tgggccacctggaaagaaggcttacctcagacaatagcagcggactgtaaggatgacctt
cctccaaatatgagattccatgaggagaagagactggactttgaatggacgttgaaggcg
ggggttctggaaatgggcctcaaacgtgtttataccctcctgagaagctggaaccatctg
gaagactttgatcagatcttctggggccagaagagtgccttggccgagaaggttcaccag
tgttggcaggaagatgaactctttggctaccagttcctcaatggcgccaaccccatgctt
ttgagacgctccacctctctgccctccagactggtactgccctctgggatggaggagctt
caagctcagttggagaaagaactcaagaatggatccctgtttgaagctgactttatcctg
ctggatggaattccagctaatgtgatccgaggagaaccacagtacctggctgcccctctt
gtcatgctgaggatggaccccggtgggaagctgctacccatggctatccagattcagccc
cctaaccccagctccccagctccaacactgttcctgccctcggatcctccacttgcctgg
ctcttggctaagatctgggtccgaaattcagatttccaactgcaggagctccaattccat
ttgctgaacacccatctggtggctgaggtcatcgctgttgccaccatgagatgcctccca
ggactgcaccctatcttcaagctcctcgttccacacatccgttacactatggaaattaac
acgcgaagccggacccagctcatctcagatggaggaatatttgatcaggtagtgagcaca
ggtggaggcggccatgttcagttgcttactcgggcagtggctcagctgacttaccactcc
ctctgtcctcctgatgatctggctaaccgaggcctgctgagaatcccaagtgctctctat
gctcgggatgctttacagctctgggaagtcactgccaggtatgtgaaggggatggtccat
ctcttctaccagagtgatgatattgtgaggggagacccagagctgcaggcctggtgtcgg
gagatcactgaagtggggctgtgccatgcccaggacagaggattccctgtctccttccag
tcccgggctcagctctgccatttcctcaccatgtgtgttttcacatgcactgcccagcat
gctgccatcaaccagggccagctggactggtatggttgggtacctaatgctccatgcaca
atgaggatgcctccgcccaccagcaaggacgacgtgacgatggagaccgtgatggggtcg
ctacctgatgtgcagaaggcctgtcttcagatgactatcacatggcacctgggtcgcctg
cagccagacatggtacctctaggacaccacacagaaaaatatttctcagacccaaggacc
aaagctgtgctcagccaatttcaagcagatttggacaatttggagaaagagattacagcc
cggaatgagcaacttgacctgccttatgaatacctcaagcccagccgcatagagaacagt
atcaccatctga

DBGET integrated database retrieval system