KEGG   Mus musculus (mouse): 11685Help
Entry
11685             CDS       T01002                                 

Gene name
Alox12e, 8-LOX, AW259591, Alox12-ps1, Alox12-ps2, Aloxe, e-LOX1
Definition
arachidonate lipoxygenase, epidermal (EC:1.13.11.31)
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    11685 (Alox12e)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    11685 (Alox12e)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    11685 (Alox12e)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     11685 (Alox12e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B3; 11 42.99 cM
AA seq 662 aa AA seqDB search
MVKYKILVATGDSVFAGSANLVHLWLVGEHGEADLGKQLRPLLGRKTELEVDVPLHLGRL
LAVKLRKQKGLLDSDWFCKSITVQGPGTQGEAFFPCYSWVQGKETICLTEGTALKVTDDT
QNLFRKYREQELENRRNVYRWGSWKEGLILPIAGSTERDLPRNQRFMKDKDLDFSLSLVK
ELKNFAIKGTLDFVSRVQKLEDYQKVFPHTKTALPERVRGSWKEDALFGYQFLNGANPML
LRRSMRLPARLVLPPGMEDVQTQLEKELKAGSLFEVDFSLLDGVKPNIIIFKQQYVTAPL
VMLKLQPDGRLLPMVIQLQPPRHGCPPPLLFLPSDPPMAWLLAKIWVRSSDFQLHQLQSH
LLRGHLMAEVISVATMRSLPSLHPIYKLLAPHFRYTMEINTLARNNLVSEWGIFDLVVST
GSGGHVDILQRATSCLTYRSFCPPDDLADRGLVGVKSSLYAQDALRLWEIISRYVERMVE
LFYRSDTDVKEDPELQVWCREVTEVGLLGAQDRGFPLSLESRAELCRFVAMCIFTCTGQH
ASTHLGQLDWYAWIPNGPCTMRKPPPISKDVTERDIVDSLPCLQQARMQITVTKFLGRRQ
PVMVALGQHKEEYFSGPRPRDVLKQFQEELAIMDKEIEVRNASLDLPYEYLRPSLVENSV
TI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagtacaagatcctcgtagccactggagactcggtttttgcgggctccgccaac
ctggtgcatctgtggctggtgggcgagcatggagaggcggaccttgggaagcagctgcgg
ccactgctgggaaggaagacagagctggaggtcgacgtccccttgcatctagggcgcctc
ctggcggtgaagctgcgcaaacagaaaggcctattggattctgactggttctgcaagagc
atcactgtgcagggccctgggacccaaggagaagcctttttcccctgctacagttgggtg
cagggcaaggagactatctgcctaaccgagggcactgccctgaaggtaactgatgacact
cagaacctgtttaggaagtatcgagagcaggagctggagaacagaaggaatgtgtatcgg
tggggctcctggaaggagggattaatcctgcctatagcagggagtactgaacgggacctc
ccccggaaccagagattcatgaaggataaggatttagatttttccctctctctggtcaaa
gagttgaagaactttgctattaaggggactctagattttgtaagtcgtgtacaaaagctg
gaagattaccagaaagtattcccacatacaaagactgctctgcctgagcgggtccgtggt
tcctggaaggaagatgctctctttgggtaccagttcctcaacggtgcaaaccccatgctc
ctgaggcggtccatgcgccttccagcccggctggtcctgcctccagggatggaagacgta
cagacccagctggagaaggagctcaaggctggatctctgttcgaagttgatttctccctg
ctggatggagtcaaacctaacatcatcatttttaagcagcaatatgtgacagcccctttg
gtcatgctgaaactacagcccgatgggaggctcttacccatggtcatccagctccagcca
ccacgacacggatgtcccccgcctctgctcttcttgccctcagatccccccatggcctgg
ctcttggccaagatctgggtccgaagctctgacttccaactgcaccagttacagtcacat
ctgctgaggggacacctcatggccgaggttatttctgtggccacaatgaggagtttaccc
agcctgcaccccatatacaagctccttgccccccactttcgatacaccatggagatcaac
accctggcacggaataatcttgtctccgaatggggaatttttgacctggtggtgagcacg
gggagcggaggccatgtggacattctccagagagccacgtcgtgtttgacctaccgctcc
ttttgccctccggatgacttggctgaccgtggactcgtgggggtgaaatcttctctgtat
gcccaggatgccctcaggctgtgggagatcatcagtcggtatgtggaaaggatggttgag
cttttctacaggagtgacaccgatgtgaaggaggacccggagctgcaggtctggtgccgc
gaggtcactgaggttggactgcttggagcccaggaccgagggttccccctgtccttagag
tcccgggctgagctgtgccgctttgtcgctatgtgcatcttcacgtgcactggtcagcac
gcatctacacatctgggtcagctggactggtatgcctggatcccaaatggcccatgcacc
atgcggaagcccccacccatctccaaggatgtgacagagagggacattgtggactcgttg
ccttgccttcagcaggcacggatgcagataacagtcaccaagttccttggcagacgccag
cctgtcatggtggccctggggcagcataaagaggagtatttctcaggccccaggccccgg
gatgtgctgaagcaattccaggaggagctggctatcatggacaaggagattgaggtccgg
aatgcaagcctggacctgccctatgagtacctccgacccagcctggtggaaaacagtgtg
accatctga

DBGET integrated database retrieval system