KEGG   Mus musculus (mouse): 11688Help
Entry
11688             CDS       T01002                                 

Gene name
Alox8, 15-LOX-2, 15-LOX-B, 8-LOX, 8S-LOX, Alox15b
Definition
(RefSeq) arachidonate 8-lipoxygenase (EC:1.13.11.33)
  KO
K08022  
arachidonate 15-lipoxygenase (second type) / 8-lipoxygenase (S-type) [EC:1.13.11.33 1.13.11.-]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    11688 (Alox8)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    11688 (Alox8)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.33  arachidonate 15-lipoxygenase
     11688 (Alox8)
    1.13.11.-  
     11688 (Alox8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 B4
AA seq 677 aa AA seqDB search
MAKCRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLDHLGKEFSAGAEEDFEVTLPQD
VGTVLMLRVHKAPPEVSLPLMSFRSDAWFCRWFELEWLPGAALHFPCYQWLEGAGELVLR
EGAAKVSWQDHHPTLQDQRQKELESRQKMYSWKTYIEGWPRCLDHETVKDLDLNIKYSAM
KNAKLFFKAHSAYTELKVKGLLDRTGLWRSLREMRRLFNFRKTPAAEYVFAHWQEDAFFA
SQFLNGINPVLIRRCHSLPNNFPVTDEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVH
TNILNGKPQFSAAPMTLLHQSSGSGPLLPIAIQLKQTPGPDNPIFLPSDDTWDWLLAKTW
VRNSEFYIHEAVTHLLHAHLIPEVFALATLRQLPRCHPLFKLLIPHIRYTLHINTLAREL
LVAPGKLIDKSTGLGTGGFSDLIKRNMEQLNYSVLCLPEDIRARGVEDIPGYYYRDDGMQ
IWGAIKSFVSEIVSIYYPSDTSVQDDQELQAWVREIFSEGFLGRESSGMPSLLDTREALV
QYITMVIFTCSAKHAAVSSGQFDSCVWMPNLPPTMQLPPPTSKGQARPESFIATLPAVNS
SSYHIIALWLLSAEPGDQRPLGHYPDEHFTEDAPRRSVAAFQRKLIQISKGIRERNRGLA
LPYTYLDPPLIENSVSI
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatgcagggtgagagtatccacgggggaagcctgtggggctggcacatgggac
aaagtgtctgtcagcatcgtgggaacccacggagagagccccttagtacctctggaccat
ctgggcaaggagttcagcgccggtgctgaagaagacttcgaggtgacgcttccccaggac
gtaggcactgtgctgatgctgcgagtccacaaagcacccccggaagtgtccctcccgctt
atgtctttccgttctgatgcctggttctgccgctggttcgagctggagtggctacctggg
gctgcactccacttcccctgttatcagtggctggaaggggcgggggagctggtgctgaga
gagggagcagcaaaggtgtcctggcaagaccatcaccctacactgcaggatcagcgccag
aaggagcttgagtccaggcagaagatgtacagctggaagacttacattgaaggttggcct
cgctgccttgaccacgagactgtgaaagacttggacctcaacatcaagtactctgcgatg
aagaatgccaaactcttctttaaagcccactccgcgtatacggagctgaaagtcaaaggg
ctcctggaccgcacaggactctggaggagtctgagggagatgagaaggctgtttaacttc
cgcaagactccagcagcagagtatgtgtttgcacactggcaggaagatgccttcttcgcc
tcccagttcctaaatggcatcaacccggtcctgattcgccgctgtcacagtctcccaaac
aacttcccggtcactgatgaaatggtggccccagtgctgggccctggaaccagtctgcag
gctgagttggagaagggctccctgttcttggtggatcatggcattctttctggagtccac
accaacatcctcaatggaaagcctcagttctctgcagccccgatgaccctgttacaccag
agctcagggtccggacccctgcttcccattgccatccagctcaaacagactcccgggcca
gacaaccccatcttcctgcccagcgatgacacgtgggactggttgctggccaagacctgg
gttcgcaattctgagttttacatccatgaggctgtcacacatctgctgcatgcccatctg
attccagaagtctttgccttggccacattacgtcagctgcctaggtgtcaccctctcttc
aagctattgattcctcacattcggtacacactgcacatcaacacgcttgcccgggagctg
ctcgttgcccctgggaagttgatagacaagtccacaggccttggcactgggggattctct
gacctgataaagagaaacatggagcagctgaactactctgtcctgtgtctccctgaagat
atccgagcccgaggtgtggaagacatcccaggctactattaccgagatgatgggatgcag
atctggggggcaataaagagctttgtctctgaaatagtcagcatctactatccaagtgac
acatccgtccaagatgaccaagagctccaggcctgggtgagggagatcttctctgagggc
ttcctcggccgagaaagctcaggtatgccctccttgttggatacccgggaagccctggtc
cagtatatcaccatggtgatattcacctgctcagccaagcatgcagctgtcagttcaggc
cagttcgactcttgtgtttggatgcccaatctgccacctaccatgcagctaccaccacct
acttccaaaggccaggcccggcctgagagtttcatagccacgctcccagcagttaattcg
tcaagttatcacatcattgctctctggctgctaagcgcagaacctggggaccaaaggccc
ctgggccactatccagatgaacacttcacagaggatgccccccggcgaagcgtggctgcc
ttccagagaaagctgatccagatctccaagggcatcagggagaggaaccgaggcctggca
ctgccctacacctacctggatcctcccctcattgagaacagtgtctccatctaa

DBGET integrated database retrieval system