KEGG   Mus musculus (mouse): 11739Help
Entry
11739             CDS       T01002                                 

Gene name
Slc25a4, AU019225, Ant1
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 4
  KO
K05863  
solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Necroptosis
Cellular senescence
Parkinson's disease
Huntington's disease
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    11739 (Slc25a4)
   04022 cGMP - PKG signaling pathway
    11739 (Slc25a4)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    11739 (Slc25a4)
   04218 Cellular senescence
    11739 (Slc25a4)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    11739 (Slc25a4)
   05016 Huntington's disease
    11739 (Slc25a4)
  Infectious diseases
   05166 HTLV-I infection
    11739 (Slc25a4)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    11739 (Slc25a4)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   11739 (Slc25a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 B1.1; 8 26.22 cM
AA seq 298 aa AA seqDB search
MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggggatcaggctttgagctttcttaaggacttcctggcaggtggcatcgccgccgcc
gtctccaagacggcggtcgccccgatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgcagagaagcagtacaaaggcatcattgattgtgtcgtgaga
atccccaaggagcagggctttctctctttctggaggggtaacctggccaacgtgatccgg
tacttccccactcaagccctgaacttcgccttcaaagacaagtacaagcagatcttcctg
ggaggcgtggatcgccataagcagttctggcgctactttgctggtaacctggcctctggt
ggggcagctggggccacctccctctgcttcgtctacccgctggactttgctaggaccagg
ctggctgccgacgtgggcaagggatcttcccagcgagaattcaatgggctgggcgactgt
ctcaccaagatcttcaagtcggacggcctgaagggtctctaccagggtttcagtgtctct
gtccagggcatcatcatctacagagctgcctacttcggagtctatgacactgccaagggg
atgctgccagaccccaagaatgtgcacattatcgtgagctggatgattgcccagagtgtg
acagcggtggcggggctggtgtcctatccgtttgacactgttcgtcgtaggatgatgatg
cagtctggccggaaaggggctgatattatgtacacggggacacttgactgctggaggaag
attgcaaaagatgaaggagccaacgctttcttcaaaggtgcttggtccaatgtactgaga
ggcatgggtggtgcttttgtattggtattgtatgatgagatcaaaaaatatgtgtaa

DBGET integrated database retrieval system