KEGG   Mus musculus (mouse): 11739Help
Entry
11739             CDS       T01002                                 

Gene name
Slc25a4, AU019225, Ant1
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 4
  KO
K05863  
solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Parkinson's disease
Huntington's disease
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    11739 (Slc25a4)
   04022 cGMP - PKG signaling pathway
    11739 (Slc25a4)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    11739 (Slc25a4)
   05016 Huntington's disease
    11739 (Slc25a4)
  Infectious diseases
   05166 HTLV-I infection
    11739 (Slc25a4)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    11739 (Slc25a4)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   11739 (Slc25a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
8 B1.1; 8 26.22 cM
AA seq 298 aa AA seqDB search
MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggggatcaggctttgagctttcttaaggacttcctggcaggtggcatcgccgccgcc
gtctccaagacggcggtcgccccgatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgcagagaagcagtacaaaggcatcattgattgtgtcgtgaga
atccccaaggagcagggctttctctctttctggaggggtaacctggccaacgtgatccgg
tacttccccactcaagccctgaacttcgccttcaaagacaagtacaagcagatcttcctg
ggaggcgtggatcgccataagcagttctggcgctactttgctggtaacctggcctctggt
ggggcagctggggccacctccctctgcttcgtctacccgctggactttgctaggaccagg
ctggctgccgacgtgggcaagggatcttcccagcgagaattcaatgggctgggcgactgt
ctcaccaagatcttcaagtcggacggcctgaagggtctctaccagggtttcagtgtctct
gtccagggcatcatcatctacagagctgcctacttcggagtctatgacactgccaagggg
atgctgccagaccccaagaatgtgcacattatcgtgagctggatgattgcccagagtgtg
acagcggtggcggggctggtgtcctatccgtttgacactgttcgtcgtaggatgatgatg
cagtctggccggaaaggggctgatattatgtacacggggacacttgactgctggaggaag
attgcaaaagatgaaggagccaacgctttcttcaaaggtgcttggtccaatgtactgaga
ggcatgggtggtgcttttgtattggtattgtatgatgagatcaaaaaatatgtgtaa

DBGET integrated database retrieval system