KEGG   Mus musculus (mouse): 11761Help
Entry
11761             CDS       T01002                                 

Gene name
Aox1, AI196512, AI255253, Ao, Aox-1, Aox-2, Aox2, Moro, Ro
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    11761 (Aox1)
   00350 Tyrosine metabolism
    11761 (Aox1)
   00380 Tryptophan metabolism
    11761 (Aox1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    11761 (Aox1)
   00760 Nicotinate and nicotinamide metabolism
    11761 (Aox1)
   00830 Retinol metabolism
    11761 (Aox1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    11761 (Aox1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     11761 (Aox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C1-C2; 1 28.86 cM
AA seq 1333 aa AA seqDB search
MDPIQLLFYVNGQKVVEKNVDPEMMLLPYLRKNLRLTGTKYGCGGGGCGACTVMISRYNP
STKAIRHHPVNACLTPICSLHGTAVTTVEGLGNTRTRLHPIQERIAKCHGTQCGFCTPGM
VMSMYALLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKASGCCQSKENGVCCL
DQEINGLAESQEEDKTSPELFSEEEFLPLDPTQELIFPPELMRIAEKQPPKTRVFYGERV
TWISPVTLKELVEAKFKYPQAPIVMGYTSVGPEVKFKGVFHPIIISPDRIEELGVISQAR
DGLTLGAGLSLDQVKDILADIVQKLPEEKTQTYRALLKHLRTLAGSQIRNMASLGGHIVS
RHLDSDLNPLLAVGNCTLNLLSKDGERRIPLSEEFLRKCPEADLKPQEVLVSVNIPWSRK
WEFVSAFRQAQRQQNALAIVNSGMRVLFREGGGVIEELSILYGGVGSTIISAKNSCQRLI
GRPWNEGMLDTACRLVLDEVTLAASAPGGKVEFKRTLIISFLFKFYLEVSQGLKREDPGH
SPSLAGNHESALDDLHSKHPWRTLTHQNVDPAQLPQDPIGRPIMHLSGIKHATGEAIYCD
DMPAVDRELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIITADHLQEANTFGTETFLAT
DEVHCVGHLVCAVIADSETRAKQAAKQVKVVYQDLAPLILTIEEAIQHKSFFKSERKLEC
GNVDEAFKIVDQILEGEIHIGGQEHFYMETQSMLVVPKGEDGEIDIYVSTQFPKYIQDIV
AATLKLSANKVMCHVRRVGGAFGGKVGKTSILAAITAFAASKHGRAVRCILERGEDMLIT
GGRHPYLGKYKAGFMNDGRILALDVEHYCNGGCSLDESLWVIEMGLLKLDNAYKFPNLRC
RGWACRTNLPSNTALRGFGFPQAGLVTEACITEVAIKCGLSPEQVRTINMYKHVDTTHYK
QEFSAKALSECWRECMAKCSYFERKAAIGKFNAENSWKKRGMAVIPLKFPVGIGSVAMGQ
AAALVHIYLDGSALVSHGGIEMGQGVHTKMIQVVSRELRMPMSSVHLRGTSTETVPNTNA
SGGSVVADLNGLAVKDACQTLLKRLEPIISKNPQGTWKDWAQTAFDQSISLSAVGYFRGY
ESNIDWEKGEGHPFEYFVFGAACSEVEIDCLTGDHKNIRTNIVMDVGHSINPALDIGQVE
GAFIQGMGLYTIEELSYSPQGTLYSRGPNQYKIPAICDIPTEMHISFLPPSEHSNTLYSS
KGLGESGVFLGCSVFFAIHDAVKAARQERGISGPWKLNSPLTPEKIRMACEDKFTKMIPR
DEPGSYVPWNIPV
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atggaccccattcagctgctcttctacgtgaatggccagaaggtggtagaaaaaaatgtc
gatcctgaaatgatgcttttaccatacctgaggaagaatctccgactcacaggaactaag
tatggctgtggaggcgggggctgtggggcctgcacagtgatgatctcgcggtacaacccc
agcaccaaggcgatcaggcatcatcctgtcaatgcctgtctgacccccatctgctctcta
catggtacagcagtcaccacggtagaaggcttaggcaacaccaggaccaggcttcatcct
attcaggagagaattgccaagtgtcacggcacccagtgtggattctgtactcctgggatg
gtgatgtccatgtacgcactgctcaggaaccatccagagcccactctagatcagttaact
gatgcccttggtgggaatctgtgccgctgcactggatataggcccataattgatgcctgc
aagactttctgtaaagcctctggctgctgtcaaagtaaagaaaatggggtgtgctgtttg
gatcaagaaataaatggattggcagaatcccaggaagaagataagacaagtccagaactg
ttctcagaagaggaatttctgccactggacccgacccaagagctgatatttcctcccgag
ctaatgagaatagctgagaaacagccaccaaagaccagagtgttttatggtgagagggtg
acatggatttcccccgtgactctgaaggaacttgtggaagctaaattcaagtatccccag
gcccctattgtcatggggtacacttctgtgggacctgaagtaaagtttaaaggtgtcttc
caccccatcataatttctcctgacagaattgaagagctgggtgtcataagccaggccagg
gatgggctgaccctgggtgctggcctcagcctggatcaggtgaaggacattctggctgat
atagtccagaagcttccagaagagaagacacagacataccgtgctctcctgaagcacctg
agaactctggctggctcccagatcaggaacatggcttctctagggggccacattgtgagc
agacatctggactcagatctgaatccccttctggctgtgggtaactgtaccctcaactta
ctgtccaaagatggagaacggcggatccctttaagtgaagagtttctccgaaagtgtcct
gaagcagatcttaagcctcaggaagtcttggtctcagtgaacatcccctggtccaggaag
tgggagtttgtgtcagccttccgtcaagcgcaaagacaacagaatgcactagcaatagtc
aactccggaatgagagtcctttttagagaaggaggtggcgtcattgaagagttatccatt
ttgtatggaggtgtcggttcaactatcatcagtgccaagaactcctgtcagagactcatt
gggaggccctggaatgaagggatgctggacacagcctgtaggctggttttggatgaagtc
acccttgcagcctcagctcctggtgggaaggtggagttcaagaggaccctcatcatcagc
ttccttttcaagttctacctggaggtgtcacagggtttgaagagggaggacccaggtcac
tctcctagcctggcaggcaaccatgagagtgctttagatgatcttcattcaaaacatccc
tggagaacattaacccaccagaatgtagatccagcacagctgcctcaggaccccattgga
cgtcccatcatgcacctttctgggattaaacatgccacgggcgaggccatctactgtgac
gacatgcctgcagtagaccgggagcttttcctcacttttgtaacaagttcaagagcacac
gctaagattgtgtccattgatctgtcggaagctctcagcctgcctggtgtggtggacatc
attactgcagatcatcttcaggaagcaaacaccttcggcacagagacatttctggccaca
gatgaggtacactgcgtgggccatcttgtctgtgctgtgattgcagattctgagacacgg
gcaaagcaagcggcgaagcaagtgaaggtggtctaccaagacttggcgcctctgatccta
acgattgaggaagctatacaacacaagtccttcttcaagtcagaacggaagctggagtgt
gggaatgttgacgaagcatttaaaatcgttgatcaaattcttgaaggtgaaatacacata
ggcggccaggaacatttttatatggaaacccaaagcatgcttgttgttcccaaaggagag
gatggagagattgacatctatgtgtctacacagtttcccaaatatatacaggatatagtc
gctgcaaccttgaagctctcagccaacaaggtcatgtgtcatgtaaggcgtgttggcggg
gcatttggagggaaggtgggcaagaccagcatcttggcagccatcactgcatttgctgct
agcaaacacggtcgcgcagtccgctgcattctggaacgaggagaagacatgttaataact
ggaggccgccatccttaccttggaaagtataaagctggattcatgaatgacggcagaatc
ttggccctggacgtggagcactactgcaatggagggtgctccctggatgagtcactatgg
gtgatagaaatggggcttctgaagctggacaacgcttacaagtttcccaacctacgctgc
cggggctgggcctgcagaaccaaccttccatccaacactgctctgcgtgggtttggcttt
cctcaggcagggctggtcaccgaagcctgtatcacagaagtggcaatcaaatgtggcctg
tcccctgagcaggttcgaaccataaatatgtacaagcacgttgatactacccattacaag
caagagttcagcgccaaggccctctctgagtgctggagagagtgcatggccaagtgttcc
tactttgagaggaaagcagccataggaaaattcaacgcagagaattcctggaagaagaga
ggaatggctgtgattcccctgaagtttcctgtgggtattggatcagtagccatgggacag
gcagctgccttggttcatatttatttggatggctctgcactggtctctcatggtggaatt
gagatggggcagggtgtgcacactaaaatgattcaggtggtcagccgggaactaaggatg
ccgatgtccagtgtccacctgcgtgggacaagcacagaaaccgtccccaacacaaatgcc
tctggaggctctgtggtggcagatctcaatggactggcagtaaaggatgcctgtcagacc
cttctaaaacgccttgaacccatcatcagcaagaatcctcagggaacttggaaggattgg
gcccagactgcttttgaccaaagcatcagtctctcggctgttggatatttcaggggttat
gagtcgaatatagactgggagaaaggggaaggtcatcccttcgaatactttgtgtttgga
gctgcctgctcagaggttgaaatagactgcctgactggggaccataagaatatcagaaca
aacatcgtgatggatgttggccacagcataaacccagcccttgacataggtcaggttgaa
ggtgcatttattcaaggaatgggactttacacaatagaggagctgagttactctcctcag
ggcactctatacagtcgtggtccaaaccaatacaagattcctgccatctgtgacatcccc
acggaaatgcacatttcttttttgcccccatctgaacactcaaacaccctgtattcatct
aagggcctgggagagtctggggtgtttctgggatgttcggtattttttgccatccatgat
gcagtgaaggcagcgcggcaggagagaggcatctctggaccatggaaactcaacagtcct
ctgactccagagaaaatcagaatggcctgtgaagataagttcaccaaaatgatcccaaga
gatgagcctggatcctatgttccctggaacatacctgtgtga

DBGET integrated database retrieval system