KEGG   Mus musculus (mouse): 11770Help
Entry
11770             CDS       T01002                                 

Gene name
Fabp4, 422/aP2, ALBP/Ap2, Ap2, Lbpl
Definition
(RefSeq) fatty acid binding protein 4, adipocyte
  KO
K08753  
fatty acid-binding protein 4, adipocyte
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    11770 (Fabp4)
   03320 PPAR signaling pathway
    11770 (Fabp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
3 A1; 3 2.56 cM
AA seq 132 aa AA seqDB search
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKN
TEISFKLGVEFDEITADDRKVKSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVM
KGVTSTRVYERA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgcctttgtgggaacctggaagcttgtctccagtgaaaacttcgatgattac
atgaaagaagtgggagtgggctttgccacaaggaaagtggcaggcatggccaagcccaac
atgatcatcagcgtaaatggggatttggtcaccatccggtcagagagtacttttaaaaac
accgagatttccttcaaactgggcgtggaattcgatgaaatcaccgcagacgacaggaag
gtgaagagcatcataaccctagatggcggggccctggtgcaggtgcagaagtgggatgga
aagtcgaccacaataaagagaaaacgagatggtgacaagctggtggtggaatgtgttatg
aaaggcgtgacttccacaagagtttatgaaagggcatga

DBGET integrated database retrieval system