KEGG   Mus musculus (mouse): 11783Help
Entry
11783             CDS       T01002                                 

Gene name
Apaf1, 6230400I06Rik, Apaf-1, Apaf1l, fog, mKIAA0413
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  
apoptotic protease-activating factor
Organism
mmu  Mus musculus (mouse)
Pathway
Platinum drug resistance
p53 signaling pathway
Apoptosis
Apoptosis - multiple species
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Tuberculosis
Hepatitis B
Small cell lung cancer
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    11783 (Apaf1)
   04215 Apoptosis - multiple species
    11783 (Apaf1)
   04115 p53 signaling pathway
    11783 (Apaf1)
 Human Diseases
  Cancers
   05222 Small cell lung cancer
    11783 (Apaf1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    11783 (Apaf1)
   05012 Parkinson's disease
    11783 (Apaf1)
   05014 Amyotrophic lateral sclerosis (ALS)
    11783 (Apaf1)
   05016 Huntington's disease
    11783 (Apaf1)
  Infectious diseases
   05134 Legionellosis
    11783 (Apaf1)
   05152 Tuberculosis
    11783 (Apaf1)
   05161 Hepatitis B
    11783 (Apaf1)
  Antineoplastic resistance
   01524 Platinum drug resistance
    11783 (Apaf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10 45.47 cM; 10 C3-D1
AA seq 1249 aa AA seqDB search
MDAKARNCLLQHREALEKDIKTSYIMDHMISNGVLSVIEEEKVKSQATQYQRAAALIKMI
LNKDNCAYISFYNALLHEGYKDLAALLQSGLPLVSSSSGKDTDGGITSFVRTVLCEGGVP
QRPVIFVTRKKLVHAIQQKLWKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSLLEGCFSG
GVHWVSIGKQDKSGLLMKLQNLCMRLDQEESFSQRLPLNIEEAKDRLRVLMLRKHPRSLL
ILDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKHVVPVESGLGREKGLEILSLFVN
MKKEDLPAEAHSIIKECKGSPLVVSLIGALLRDFPNRWAYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCVLWDLETEEVEDILQEFVN
KSLLFCNRNGKSFCYYLHDLQVDFLTEKNRSQLQDLHRKMVTQFQRYYQPHTLSPDQEDC
MYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVAYRHILDEKDCAV
CENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYRQAKLQAKQEGDTGRLYLEWINK
KTIKNLSRLVVRPHTDAVYHACFSQDGQRIASCGADKTLQVFKAETGEKLLDIKAHEDEV
LCCAFSSDDSYIATCSADKKVKIWDSATGKLVHTYDEHSEQVNCCHFTNKSNHLLLATGS
NDFFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDELLASCSADGTLRLWDVRSANERKS
INVKRFFLSSEDPPEDVEVIVKCCSWSADGDKIIVAAKNKVLLFDIHTSGLLAEIHTGHH
STIQYCDFSPYDHLAVIALSQYCVELWNIDSRLKVADCRGHLSWVHGVMFSPDGSSFLTA
SDDQTIRVWETKKVCKNSAIVLKQEIDVVFQENETMVLAVDNIRGLQLIAGKTGQIDYLP
EAQVSCCCLSPHLEYVAFGDEDGAIKIIELPNNRVFSSGVGHKKAVRHIQFTADGKTLIS
SSEDSVIQVWNWQTGDYVFLQAHQETVKDFRLLQDSRLLSWSFDGTVKVWNVITGRIERD
FTCHQGTVLSCAISSDATKFSSTSADKTAKIWSFDLLSPLHELKGHNGCVRCSAFSLDGI
LLATGDDNGEIRIWNVSDGQLLHSCAPISVEEGTATHGGWVTDVCFSPDSKTLVSAGGYL
KWWNVATGDSSQTFYTNGTNLKKIHVSPDFRTYVTVDNLGILYILQVLE
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaaggcccgcaattgtttgcttcaacatagagaagctttggaaaaggacatc
aaaacatcctacatcatggatcacatgatcagtaatggcgtcttgtcagtgatagaggag
gagaaggtcaaaagtcaggccactcaatatcaacgagcagccgctttaattaaaatgata
cttaataaagacaactgtgcctacatttcattctacaacgctctgctacacgagggctat
aaggaccttgctgcgcttctgcagagtggccttcctcttgtgtcgtcttccagtggcaag
gacacagatggtggaataacttcatttgtaaggacagtgctgtgtgaaggtggagtaccc
cagaggccggttattttcgttactagaaagaagctggttcatgcgattcagcagaagctc
tggaaactgaatggagaaccagggtgggtcaccatctatgggatggcaggctgcggcaag
tctgtgttagctgcggaagccgttcgagatcactccctcttagaaggttgcttttcaggg
ggtgtacactgggtttccattggaaaacaagacaaatctgggcttctcatgaaactgcag
aatctgtgcatgcgcttggaccaagaagagagtttctctcagaggcttccacttaatatt
gaggaggccaaagaccgcctccgtgttctgatgctgcgcaaacacccaaggtctctgttg
atcttggatgatgtttgggatccttgggtgttaaaagcttttgacaatcagtgtcagatt
cttcttacaaccagagataagagtgttacagattcagtaatgggtcctaagcatgttgtc
cctgtggagagtggtctagggagagagaaaggacttgagatcttgtcactttttgttaac
atgaagaaagaagatctgccagcggaggctcacagtattataaaggaatgcaaaggttct
cctcttgtagtgtctttaattggtgcgcttttacgtgattttcccaatcgctgggcatac
tacctcagacagcttcagaataagcagtttaagagaataaggaagtcttcatcttatgat
tatgaggctctagatgaagccatgtcgataagtgttgaaatgctcagagaagacatcaaa
gactattacacagacctttccatccttcagaaggacgtcaaggtacctacaaaggtgttg
tgcgttctctgggacttggaaacggaagaagttgaagacatcctgcaggagttcgttaat
aagtctctcttattctgtaatcggaatggaaagtcattttgttattatttacatgatctt
caagtagattttcttacagagaagaatcgcagtcagcttcaggatctgcacaggaagatg
gtcactcagtttcagaggtattaccagccccacacgctgtctccagaccaggaggactgc
atgtattggtacaacttcctagcctatcacatggctagtgccaatatgcacaaagaactt
tgtgctttaatgttttccctggactggattaaagcaaaaacagaacttgtcggccctgcc
catctgattcacgagttcgtggcatataggcatatattggatgaaaaggattgtgcagtc
tgtgagaattttcaagagtttttatctttaaatggacacctccttggacgacagccattt
cctaatattgtacagctgggcctctgtgaaccagaaacttccgaagtttatcgacaagca
aagctgcaggccaagcaggagggggatactgggcgcctttacctggaatggataaacaaa
aaaactatcaagaatctgtcccgcttagtcgtccgcccccacacagatgctgtttaccac
gcgtgtttttctcaggatggtcagagaatagcttcttgtggggctgataaaaccttacag
gtgttcaaagccgagacaggagagaaacttcttgacatcaaagctcacgaagatgaggtg
ctttgctgcgcgttctcctcagacgacagttacatagcgacctgctcagcggataagaag
gttaagatttgggattctgcgactgggaagcttgtgcacacctacgacgagcactcggag
caagtcaattgctgccatttcaccaacaagagtaaccaccttctcttggccactgggtca
aatgatttcttcctcaagctctgggatttgaatcaaaaagaatgtcgaaataccatgttt
ggtcacacgaactcagtcaaccactgcaggttctcaccagacgatgagctcttggctagc
tgctcagctgacgggactttaaggctttgggatgtgagatcagcaaacgagaggaaaagc
attaatgtgaagcgcttcttcctgagttcagaagaccctccagaggatgtggaggtgatc
gtgaagtgttgttcctggtctgcagatggtgacaaaataatagtggcagcaaaaaacaaa
gtcctcctttttgatattcatactagtggcctattggcagagatccacacaggccatcac
agcaccatccagtactgtgacttctccccctatgaccatttggctgtgattgccctgtct
cagtactgtgtggagttgtggaacatagactcccgcctaaaggtggccgactgcagagga
catttgagttgggttcacggtgtgatgttttctcccgatggctcctcatttttgacagct
tctgatgaccaaacaataagggtctgggagacaaaaaaggtatgcaagaactctgccatc
gtgctaaagcaggaaatagacgtcgtgtttcaagagaacgaaacgatggtccttgcagtt
gacaacataagaggcctgcaactcattgctggaaaaacaggccagattgattacctgcct
gaagcccaagtgagttgctgctgcctcagtccacaccttgagtacgtggcattcggagat
gaagatggagccattaagattatagaacttccaaacaacagagtcttcagttctggggtt
gggcacaagaaagctgtgcggcacatccagttcacagctgatgggaagacactgatttca
agttctgaagattctgtgattcaggtatggaattggcagacaggggactatgtatttttg
caagcccaccaggaaacggtaaaggacttcaggctcctccaagattcaagattgctttct
tggtcatttgatggaacggtgaaggtgtggaatgtcattaccggaagaatagaaagagac
tttacttgtcatcagggcacagtgctttcctgtgctatctcttctgatgcgaccaagttt
tcatctacctctgctgataagactgccaagatctggagttttgacctcctttcccctctt
catgagctgaagggccataatggctgtgtccgctgctctgccttctcgctggatggcatc
ctgttggcaactggagatgacaatggagaaatccggatatggaatgtctcagatggccag
cttcttcattcgtgtgctccgatctcggtagaggaaggaactgctacccacggcggctgg
gtaactgatgtgtgcttctctcccgacagtaaaacgcttgtctctgctggaggatatctc
aagtggtggaatgttgccactggggactcctcacagaccttctacacaaatggaacaaac
ctcaagaaaatccacgtgtcccctgacttcagaacctatgtgactgtcgataatctcggt
attttatatattttacaggttttagagtga

DBGET integrated database retrieval system