KEGG   Mus musculus (mouse): 11789Help
Entry
11789             CDS       T01002                                 

Gene name
Apc, AI047805, AU020952, AW124434, CC1, Min, mAPC
Definition
adenomatosis polyposis coli
Orthology
K02085  
adenomatosis polyposis coli protein
Organism
mmu  Mus musculus (mouse)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Colorectal cancer
Endometrial cancer
Basal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:mmu04310]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:mmu04390]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mmu05206]
Human Diseases; Cancers; Colorectal cancer [PATH:mmu05210]
Human Diseases; Cancers; Basal cell carcinoma [PATH:mmu05217]
Human Diseases; Cancers; Endometrial cancer [PATH:mmu05213]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18 B1; 18 18.53 cM
AA seq 2842 aa AA seqDB search
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDETM
TSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRT
FVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQT
DMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRVRQLLQSQAAEA
ERSSQSRHDAASHEAGRQHEGHGVAESNTAASSSGQSPATRVDHETASVLSSSGTHSAPR
RLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHG
NDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWE
WQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVD
CEMYGLTNDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQ
VIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTEN
KADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCL
QTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGS
AAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPK
ASHRSKQRHKQNLYGDYAFDANRHDDSRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLD
SSRSEKDRSLERERGIGLSAYHPTTENAGTSSKRGLQITTTAAQIAKVMEEVSAIHTSQD
DRSSASTTEFHCVADDRSAARRSSASHTHSNTYNFTKSENSNRTCSMPYAKVEYKRSSND
SLNSVTSSDGYGKRGQMKPSVESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELD
TPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEIKQNEQRQARSQNTSYPVYSENT
DDKHLKFQPHFGQQECVSPYRSRGTSGSETNRMGSSHAINQNVNQSLCQEDDYEDDKPTN
YSERYSEEEQHEEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQKPSFSFSKNS
SAQSTKPEHLSPSSENTAVPPSNAKRQNQLRPSSAQRNGQTQKGTTCKVPSINQETIQTY
CVEDTPICFSRCSSLSSLSSADDEIGCDQTTQEADSANTLQTAEVKENDVTRSAEDPATE
VPAVSQNARAKPSRLQASGLSSESTRHNKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETP
LVFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPP
PPQTVQAKREVPKSKVPAAEKRESGPKQTAVNAAVQRVQVLPDVDTLLHFATESTPDGFS
CSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPEESNENQDKEVEKPDSEKD
LLDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPPVARKPSQLPVYKLLPAQN
RLQAQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELATGDGVRAGIQSG
EFEKRDTIPTEGRSTDDAQRGKISSIVTPDLDDNKAEEGDILAECINSAMPKGKSHKPFR
VKKIMDQVQQASSTSSGANKNQVDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTE
ETFSDNKDSKKPSLQTNAKAFNEKLPNNEDRVRGSFALDSPHHYTPIEGTPYCFSRNDSL
SSLDFDDDDVDLSREKAELRKGKESKDSEAKVTCRPEPNSSQQAASKSQASIKHPANRAQ
SKPVLQKQPTFPQSSKDGPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNNN
KESEPIKEAEPANSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQE
CISSAMPKKKRPSRLKSESEKQSPRKVGGILAEDLTLDLKDLQRPDSEHAFSPDSENFDW
KAIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFT
SNKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLPTN
MPSISRGRTMIHIPGLRNSSSSTSPVSKKGPPLKTPASKSPSEGPGATTSPRGTKPAGKS
ELSPITRQTSQISGSNKGSSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISPPN
KLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLTKQASLSKNASSIPRSESASKG
LNQMSNGNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEESA
SFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYNDG
RPTKRHDIARSHSESPSRLPINRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSES
SEKAKSEDERHVSSMPAPRQMKENQVPTKGTWRKIKESDISPTGMASQSASSGAASGAES
KPLIYQMAPPVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGSSSIKDSKDT
HGKQSVGSGSPVQTVGLETRLNSFVQVEAPEQKGTEAKPGQSNPVSIAETAETCIAERTP
FSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVSTNTKKRDSKTD
STESSGAQSPKRHSGSYLVTSV
NT seq 8529 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaagcagctacagggaagtattgaagatgagactatg
acttctggacagattgacttactagagcgtcttaaagaatttaacttagatagtaatttc
cccggagtgaaactacgctcaaaaatgtcccttcgctcctacggaagtcgggaaggatct
gtatccagccgttcaggagaatgcagtcctgtccccatggggtcattcccaagaagaaca
tttgtaaatggaagcagagagagtactgggtatctagaagagcttgaaaaagaaagatca
ttactccttgctgatcttgacaaagaagagaaggaaaaggactggtattatgctcaactt
cagaacctcacaaaaagaatagatagcctgcctttaactgaaaatttttccttacagaca
gacatgacaagacggcagctggagtatgaagcaaggcagatcagggctgcaatggaggag
cagcttggcacctgccaggacatggagaagcgtgcacagcgaagaatagccaggatccag
caaatagaaaaggacatactgcgcgtgcgccagcttttacagtcccaggcggcggaagcg
gagaggtcatctcagagcaggcatgatgctgcctcccatgaagctggccggcagcacgaa
ggccacggagtggcagaaagcaacaccgcagcctccagtagtggtcagagtccagctaca
cgtgtggatcacgaaacagccagtgttttgagttctagcggcacgcactctgctcctcga
aggttgacaagtcatctggggacaaaggtggaaatggtgtattccttgttgtcaatgctt
ggtactcatgataaggacgatatgtcacgaactttgctagctatgtccagctcccaagac
agctgtatatccatgcggcagtctggatgtcttcctctcctcatccagcttttacatggc
aatgacaaagactctgtattgttgggaaattcccggggcagtaaagaggctcgggccagg
gccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggcaggcgt
gaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgttgggag
tggcaggaagcccacgaacaaggcatggaccaggacaaaaacccaatgccagctcctgtt
gagcatcagatctgtcctgctgtgtgtgttctaatgaagctttcatttgatgaagagcat
aggcatgcaatgaatgaacttgggggactgcaggccattgcagagttattgcaggtggac
tgtgagatgtatgggcttactaatgaccactacagtgttactttaagacggtatgctgga
atggctttgacaaacttgacctttggagatgttgccaacaaggctacgctgtgttctatg
aaaggctgcatgagagcacttgtggcccagttaaaatctgagagtgaagacttacagcag
gttattgcaagtgttttgaggaatttgtcttggcgagcagatgtaaatagcaaaaagacg
ttgagagaagttggaagtgtgaaagcattgatggaatgtgctttggaagttaaaaaggaa
tcaaccctcaaaagcgttttgagtgccttatggaacctgtctgcacactgcactgagaat
aaggctgacatctgtgctgtggatggagcactggcatttctggttggcaccctcacttac
cggagccagacaaatactttagccattattgaaagtggaggtgggatattacggaatgtg
tccagcttgatagctacaaacgaagaccacaggcaaatcctaagagagaacaattgccta
caaactttattacagcacttgaaatctcacagcttgacaatagtcagtaatgcatgtgga
actttgtggaatctctcagcaagaaatcctaaagaccaggaagccttgtgggacatgggg
gcagtgagcatgctcaagaacctcattcattccaagcacaaaatgattgccatgggaagt
gcagcagctttaaggaatctcatggcaaacagacctgcaaagtataaggatgccaatatc
atgtctcccggctcaagtctgccatcccttcacgttaggaaacagaaagctctagaagct
gagctagatgctcagcatttatcagaaaccttcgacaacattgacaacctaagtcccaag
gcctctcaccggagtaagcagagacacaagcagaatctttatggtgactatgcttttgac
gccaatcgacatgatgatagtaggtcagacaatttcaatactggaaacatgactgttctt
tcaccatatttaaatactacggtattgcccagctcttcttcctcaaggggaagtttagac
agttctcgttctgagaaagacagaagtttggagagagagcgaggtattggcctcagtgct
taccatccaacaacagaaaatgcaggaacctcatcaaaacgaggtctgcagatcactacc
actgcagcccagatagccaaagttatggaagaagtatcagccattcatacctcccaggac
gacagaagttctgcttctaccaccgagttccattgtgtggcagacgacaggagtgcggca
cgaagaagctctgcctcccacacacactcaaacacatacaacttcactaagtcggaaaat
tcaaataggacatgctctatgccttatgccaaagtggaatataaacgatcttcaaatgac
agtttaaatagtgtcactagtagtgatggatatggtaaaagaggccaaatgaaaccctca
gttgaatcctattctgaagatgatgaaagtaaattttgcagttatggtcagtatccagct
gacctagcccataagatacacagtgcaaatcatatggatgataatgatggagaactggat
acaccaataaattacagtcttaaatattcagatgagcagttgaactcaggaaggcagagt
ccctcacagaatgaaaggtgggcaagaccaaagcatgtgatagaagatgaaataaagcaa
aacgagcaaagacaagcaagaagccagaacaccagttatcctgtctattctgagaatacc
gatgacaaacacctcaaattccaaccacattttggacaacaagaatgtgtttccccatat
aggtcaaggggaaccagtggttcagaaacaaatcgaatgggttctagtcatgcaattaat
caaaatgtaaaccagtctctgtgtcaggaagatgattatgaagatgataaacctaccaac
tacagtgaacgttattctgaggaagaacaacatgaagaagaagaagagagaccgacaaat
tatagcataaaatataatgaagagaaacatcatgtggatcagcctattgattatagttta
aaatatgccactgacatttcttcctcacaaaaaccatcattttcattctcaaagaattca
tcagcacaaagcactaaacctgaacatctctctccaagcagcgagaatacagctgtacct
ccatctaatgccaaaaggcagaatcagctgcgtccaagttcagcacaaagaaatggccag
actcaaaaaggcactacttgcaaagtcccctccatcaaccaagaaacaatacagacttac
tgcgtagaagacaccccaatatgtttttcaaggtgcagttcattatcatcactgtcatca
gctgacgatgaaataggatgtgatcagacaacacaggaagcagattctgctaatactctg
cagacagcagaagtaaaagagaatgatgtaactcggtcagctgaagatcctgcaactgaa
gttccagcagtgtcccagaatgctagagccaaacccagccgactccaggcttctggctta
tcttcagaatcaaccaggcataataaagctgttgagttttcttcaggagccaagtctccc
tccaaaagtggtgctcagacacccaaaagtcccccagaacactatgtccaggagactccg
ctcgtattcagcaggtgtacttctgtcagctcccttgacagttttgagagtcgctccatt
gccagctctgttcagagtgagccatgtagtggaatggtgagtggcatcataagccccagt
gaccttccagatagtcctgggcagaccatgccaccaagcagaagcaaaacccctccacct
cctccacagacagtgcaggccaagagagaggtgccaaaaagtaaagtccctgctgctgag
aagagagagagtgggcctaagcagactgctgtaaatgctgccgtgcagagggtgcaggtc
cttccagacgtggatactttgttacacttcgccacagaaagtactccagacgggttttct
tgttcctccagcctaagtgctctgagcctggatgagccatttatacagaaagatgtagaa
ttaagaatcatgcctccagttcaggaaaacgacaatgggaatgaaactgaatcagaacag
cctgaggaatcaaatgaaaaccaggataaagaggtagaaaagcctgactctgaaaaagac
ttattagatgattctgatgacgatgatattgaaatattagaagaatgtattatttcagcc
atgccaacaaagtcatcacgcaaagccaaaaaactagcccagactgcttcaaaattacct
ccacctgtggcaaggaaaccaagtcagctacctgtgtataaacttctgccagcacagaat
aggctgcaggcacaaaaacatgttagctttacaccaggggatgatgtgccccgggtgtac
tgtgtagaagggacacctataaacttttccacagcaacgtctctaagtgatctgacaata
gagtcccctccaaatgaattggctactggagatggggtcagagcgggtatacagtcaggt
gaatttgaaaaacgagataccattcctacagaaggcagaagtacagatgatgctcagcga
ggaaaaatctcatctatagttacaccagacctggatgacaacaaagcagaggaaggagat
attcttgcagaatgtatcaattctgctatgcccaaaggaaaaagccacaagcctttccga
gtgaaaaagataatggaccaagtccaacaagcatcctcgacttcatctggagctaacaaa
aatcaagtagacactaagaaaaagaagcctacttcaccagtaaagcccatgccacaaaat
actgaatatagaacgcgtgtgagaaagaatacagactcaaaagttaatgtaaatactgaa
gaaactttctcagacaacaaagactcaaagaaaccaagcttacaaaccaatgccaaggcc
ttcaatgaaaagctacctaacaatgaagacagagtgcgggggagcttcgccttggactca
ccgcatcactacacccctattgaggggacgccgtactgcttttcccgaaatgactccttg
agttctctggattttgatgatgacgatgttgacctttccagggaaaaggccgagttaaga
aagggcaaagaaagcaaggattccgaagccaaagttacctgccgcccagaaccaaactca
agccagcaggcagctagtaagtcacaagccagtataaaacatccagcaaacagagcacag
tccaaaccagtgctgcagaaacagcccactttcccccagtcctccaaagacggaccagat
agaggggcagcaactgacgaaaaactgcagaattttgctattgaaaatactccagtttgc
ttttctcgaaattcctctctgagttcccttagtgacattgaccaggaaaacaacaataac
aaagaaagtgaaccaatcaaagaagctgaacctgccaactcacaaggagagcccagtaag
cctcaggcatccgggtatgctcccaagtccttccacgtcgaagacacccctgtctgtttc
tcaagaaacagctctctcagttctcttagcattgactctgaggacgacctgttacaggag
tgtataagttctgccatgccaaaaaagaaaaggccttcaagactcaagagtgagagcgaa
aagcagagccctagaaaagtgggtggcatattagctgaagacctgacgcttgatttgaaa
gatctacagaggccagattcagaacacgctttctcccccgactcagaaaattttgactgg
aaagctattcaggaaggcgcaaactccatagtaagtagtttgcaccaagctgctgcagcc
gccgcgtgcttatctagacaagcgtcatccgactcagattccattctgtcactaaagtcc
ggcatttctctgggatcgccttttcatcttacacctgatcaagaggaaaagccattcaca
agcaataaaggcccaagaattctcaaacctggagagaaaagcacattagaagcaaaaaaa
atagaatctgaaaacaaaggaatcaaaggcgggaaaaaggtttataaaagcttgattacg
ggaaagattcgctccaattcagaaatttccagccaaatgaaacaacccctcccgacaaac
atgccttcaatctcaagaggcaggacgatgattcacatcccagggcttcggaatagctcc
tctagtacaagccctgtctctaagaaaggcccacccctcaagactccagcctctaaaagc
cccagtgaagggccgggagctaccacttctcctcgaggaactaagccagcaggaaagtca
gagcttagccctatcaccaggcaaacttcccaaatcagtgggtcaaataaggggtcttct
agatcaggatctagagactccactccctcaagacctacacagcaaccattaagtaggcca
atgcagtctccagggcgaaactcaatttcccctggtagaaatggaataagccctcctaac
aaactgtctcagctgcccagaacatcatctcccagtactgcttcaactaagtcctccggt
tctgggaaaatgtcatatacatccccaggtagacagctgagccaacaaaatcttaccaaa
caagcaagtttatccaagaatgccagcagtatccccagaagtgagtcggcatctaaagga
ctgaatcagatgagtaacggcaatgggtcaaataaaaaggtagaactttctagaatgtct
tcaactaaatcaagtggaagtgaatcagacagatcagaaaggcctgcattagtacgccag
tctactttcatcaaagaagccccaagcccaaccctgaggaggaaactggaggaatctgcc
tcatttgaatccctttctccatcttctagaccagattctcccaccaggtcgcaggcacag
accccagttttaagcccttcccttcctgatatgtctctgtccacacatccatctgttcag
gcaggtgggtggcgaaagctcccgcctaatctcagccccactatcgagtataatgacgga
aggcccacaaaacggcatgatattgcacgctcccattctgaaagtccttccagactacca
atcaaccgggcgggaacctggaagcgtgaacacagcaaacattcctcgtcccttcctcga
gtgagtacttggagaagaactggaagctcatcttctattctttctgcttcatcagagtcc
agtgaaaaagcaaaaagtgaggatgaaaggcatgtgagctccatgccagcacccagacag
atgaaggaaaaccaggtgcccaccaaaggaacatggaggaaaatcaaggaaagtgacatt
tctcccacaggcatggcttctcagagcgcttcctcaggtgctgccagtggtgctgaatcc
aagcctctgatctatcagatggcacctcctgtctctaaaacagaggatgtttgggtgaga
attgaggactgccccattaacaaccctagatctggacggtcccccacaggcaacaccccc
ccagtgattgacagtgtttcagagaagggaagttcaagcattaaagattcaaaagacacc
catgggaaacagagtgtgggcagtggcagtcctgtgcaaaccgtgggtctggaaacccgc
ctcaactcctttgttcaggtagaggccccagaacagaaaggaactgaggcaaaaccagga
cagagtaacccagtctctatagcagagactgctgagacgtgtatagcagagcgtacccct
ttcagttccagtagctccagcaagcacagctcacctagcgggactgttgctgccagagtg
acaccttttaattacaaccctagccctaggaagagcagcgcagacagcacttcagcccgg
ccgtctcagatccctacgccagtgagcaccaacacgaagaagagagattcgaagactgac
agcacagaatccagtggagcccaaagtcctaaacgccattccgggtcttacctcgtgacg
tctgtttaa

DBGET integrated database retrieval system