KEGG   Mus musculus (mouse): 11790Help
Entry
11790             CDS       T01002                                 

Gene name
Speg, AW125581, Apeg1, BPEG, D1Bwg1450e, SPEGalpha, SPEGbeta, mKIAA1297
Definition
(RefSeq) SPEG complex locus (EC:2.7.11.1)
  KO
K08809  
striated muscle-specific serine/threonine protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11790 (Speg)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  Trio family [OT]
   11790 (Speg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C4; 1 38.88 cM
AA seq 2527 aa AA seqDB search
MVVAPGADVLLKCIITANPPPQVSWKKDGSMLHSEGRLLIRAEGERHTLLLREAQAADAG
SYTATATNELGQATCASSLAVRPGGSTSPFSSPITSDEEYLSPPEEFPEPGETWPRTPTM
KLSPSQDHDSSDSSSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVR
PDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRAHPESRSLAV
LAPLQDVDVGAGEMALFECLVAGPADVEVDWLCRGRLLQPALLKCKMHFDGRKCKLLLTS
VHEDDSGVYTCKLSTAKDELTCSARLTVRPSLAPLFTRLLEDVEVLEGRAARLDCKISGT
PPPSVTWTHFGHPVNEGDNLRLQQDGGLHSLHIARVGSEDEGLYEVSATNTHGQAHCSAQ
LYVEEPRTAASGPSSKLEKMPSIPEEPEHGDLERLSIPDFLRPLQDLEVGLAKEAMLECQ
VTGLPYPTISWFHNGHRIQSSDDRRMTQYRDIHRLVFPAVGPQHAGVYKSVIANKLGKAA
CYAHLYVTDVVPGPPDGAPEVVAVTGRMVTLSWNPPRSLDMAIDPDSLTYTVQHQVLGSD
QWTALVTGLREPAWAATGLKKGIQHIFRVLSSSGKSSSKPSAPSEPVQLLEHGPPLEEAP
AVLDKQDIVYVVEGQPACVTVTFNHVEAQVVWRSCRGALLEARTGVYELSQPDDDQYCLR
ICRVSRRDLGPLTCSARNRHGTKACSVTLELAEAPRFESIMEDVEVGPGETARFAVVVEG
KPLPDIMWYKDEVLLAESNHVSFVYEENECSLVLLSAGSQDGGVYTCTARNLAGEVSCKA
ELSVLSAQTAMEVEGVGEDEEHRGRRLSDYYDIHQEIGRGAFSYLRRVVERSSGLEFAAK
FIPSQAKPKASARREARLLARLQHGCVLYFHEAFERRRGLVIVTELCTEELLERMARKPT
VCESETRTYMRQVLEGICYLHQSHVLHLDVKPENLLVWDGAGGEEQVRICDFGNAQELTP
GEPQYCQYGTPEFVAPEIVNQSPVSGVTDIWPVGVVAFLCLTGISPFVGENDRTTLMNIR
NYNVAFEETTFLSLSREARGFLIKVLVQDRLRPTAEETLEHPWFKTEAKGAEVSTDHLKL
FLSRRRWQRSQISYKCHLVLRPIPELLRAPPERVWVAMPRRQPPSGGLSSSSDSEEEELE
ELPSVPRPLQPEFSGSRVSLTDIPTEDEALGTPEAGAATPMDWQEQERTPSKDQEAPSPE
ALPSPGQESPDGPSPRRPELRRGSSAESALPRVGSREPGRSLHKAASVELPQRRSPSPGA
TRLTRGGLGEGEYAQRLQALRQRLLRGGPEDGKVSGLRGPLLESLGGRARDPRMARAASS
EAAPHHQPPPESRGLQKSSSFSQGEAEPRGRHRRAGAPLEIPVARLGARRLQESPSLSAL
SETQPPSPARPSVPKLSITKSPEPSAVTSRDSPQPPEPQPVPEKVPEPKPEPVRAAKPAQ
PPLALQMPTQPLTPYAQIMQSLQLSSPTLSPQDPAVPPSEPKPHAAVFARVASPPPGVSE
KRVPSARTPPVLAEKARVPTVPPRPGSSLSGSIENLESEAVFEAKFKRSRESPLSRGLRL
LSRSRSEERGPFRGAEDDGIYRPSPAGTPLELVRRPERSRSVQDLRVAGEPGLVRRLSLS
LSQKLRRTPPGQRHPAWESRSGDGESSEGGSSARASPVLAVRRRLSSTLERLSSRLQRSG
SSEDSGGASGRSTPLFGRLRRATSEGESLRRLGVPHNQLGSQTGATTPSAESLGSEASGT
SGSSAPGESRSRHRWGLSRLRKDKGLSQPNLSSSVQEDLGHQYVPSESDFPPVFHIKLKD
QVLLEGEAATLLCLPAACPAPRISWMKDKQSLRSEPSVVIVSCKDGRQLLSIPRAGKRHA
GLYECSATNVLGSITSSCTVAVARIPGKLAPPEVPQTYHDTALVVWKPGDGRAPCTYTLE
RRVDGESVWHPVSSGIPDCYYNVTQLPVGVTVRFRVACSNRAGQGPFSNPSEKVFIRGTP
DSPAQPAAAPRDAPVTSGPTRAPPPDSPTSLAPTPALAPPASQASTLSPSTSSMSANQAL
SSLKAVGPPPATPPRKHRGLLATQQAEPSPPSIVVTPSEPRSFVPDTGTLTPTSSPQGVK
PAPSSTSLYMVTSFVSAPPAPQAPAPEPPPEPTKVTVRSLSPAKEVVSSPTPESTTLRQG
PPQKPYTFLEEKARGRFGVVRSCRENATGRTFVAKIVPYAAEGKRRVLQEYEVLRTLHHE
RLMSLHEAYITPRYLVLIAESCGNRELLCGLSDRFRYSEDDVATYVVQLLQGLDYLHGHH
VLHLDIKPDNLLLAADNALKIVDFGSAQPYNPQALKPLGHRTGTLEFMAPEMVKGDPIGS
ATDIWGAGVLTYIMLSGYSPFYEPDPQETEARIVGGRFDAFQLYPNTSQSATLFLRKVLS
VHPWSRPSLQDCLAHPWLQDAYLMKLRRQTLTFTTNRLKEFLGEQRRRRAEAATRHKVLL
RSYPGSP
NT seq 7584 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggcgccaggagctgacgtgctacttaagtgtatcatcaccgccaacccccca
ccccaagtgtcctggaaaaaggatgggtccatgttgcacagcgagggtcgtcttctcatc
cgggctgaaggtgaacggcacacactgctgctcagagaggcccaggctgccgatgctggg
agctacacagccactgccaccaacgaactgggccaagctacctgtgcttcttcactggct
gtgagacctggcggctccacatcccctttcagcagccccatcacctctgatgaggagtac
ctgagccccccagaggagttcccagagcctggggagacctggccccgaacccctaccatg
aagctcagtcccagccaggatcatgattcctccgactcttcttccaaggcacccccaacg
ttcaaggtctcactcatggaccaatcggtgagagaaggtcaagatgtcattatgagcatc
cgtgtgcagggagagcccaagcctgtggtttcctggctgaggaatcgacagcccgtgcgc
ccagaccagcggcgctttgcagaggaggccgagggtgggctctgccgcttgaggatcctg
gctgctgaacggggcgatgctggtttctacacatgcaaggcggtcaacgaatatggcgct
cggcagtgcgaggcccgcctggaggtccgagcacaccctgaaagccggtccctggccgtg
ctggcccccctgcaggacgtggacgtgggggccggggagatggcgctgtttgagtgcctg
gtggcaggtccagctgacgtcgaggtggactggctgtgccggggccgcctgctgcagcct
gcgctgctcaaatgcaagatgcattttgatggccgcaagtgcaagctgctgctcacctct
gtgcacgaggacgacagtggtgtctacacctgcaagctgagcacagccaaagatgaactg
acctgcagtgcccggctgacggttcggccgtcgctggcgcctctcttcacccggttgctg
gaagatgtggaggtgttggaaggccgtgctgcccgcttggattgcaagatcagcggtacc
ccgcctccctccgttacctggactcattttggccaccccgtgaatgagggtgacaacttg
cggcttcaacaggatggaggtctacactcactgcacattgcccgggtgggcagtgaggac
gaaggactctatgaagtcagtgccaccaacactcatggccaggcccactgctccgcccag
ctgtatgtggaggagcctcggacagctgcctctggccccagctcgaagctggagaagatg
ccatctatccctgaggagccggagcacggagatctagagaggctgtctattcctgacttc
ctacggccactgcaagatctggaagtgggactagctaaggaggccatgctggagtgccaa
gtgaccggcctgccctatcccaccatcagctggttccacaatggccaccgcattcaaagc
agtgacgaccgacgcatgacacagtacagggacatacatcgcctggtgttcccagctgtg
gggcctcagcatgctggtgtctataagagtgtaatcgccaacaagctgggcaaagcggcc
tgctacgcccatctctatgtcacagatgtggttccaggccctccagatggtgctccggaa
gtagtagctgtgaccggaaggatggtcacactatcgtggaacccacccaggagtctggac
atggctattgacccagattccctaacatacactgtgcagcaccaggtgttgggctcggac
cagtggacggcactggtcacaggcctgcgggagcctgcgtgggcagccacagggctgaag
aaggggatccagcacatcttccgggtcctcagctccagtggcaagagcagcagcaagccc
tcagcaccgtcggaacccgtgcagctgctagagcatggcccacccctggaagaggcgcct
gctgtgctggacaagcaggacattgtgtatgtggtagagggccagcctgcctgtgtcacc
gtcacttttaaccatgtggaggcccaggttgtctggaggagctgccggggagccctcctc
gaggcgcgcacaggtgtgtatgaactgagtcagccagatgacgaccagtattgtctgcgg
atctgccgggtgagccgacgagacctgggaccccttacttgcagtgcccgaaaccgccac
ggcacaaaggcctgctcggtcaccctggagctggcagaggcacctcggtttgagtctatc
atggaagatgtggaggtggggcctggagaaaccgctcgctttgctgtggtagttgagggg
aaaccactgccagacatcatgtggtacaaggatgaggtgctgctggccgagagcaaccat
gtgagcttcgtgtatgaggagaacgagtgttccctagtgctgctcagcgcaggaagccag
gatggaggcgtctatacctgtaccgcccggaacctggcaggcgaagtctcctgcaaggcg
gagctgtctgtgctttcagctcagacagccatggaggtcgagggggtcggagaggatgag
gaacaccgaggaagaagacttagcgactactacgacatccaccaagagattggcaggggt
gccttctcctacctgcggcgtgtagtggagaggagctctggcctggagtttgcagccaag
ttcatccctagccaggctaagcctaaagcatcagcaagacgcgaggcgcgcttgctggcc
cggctccagcatggctgtgtgctctacttccacgaagcctttgagaggcgcaggggactt
gtcatagtcacggagctctgcacagaagagcttctagagcgcatggccaggaagcccacc
gtgtgtgagtctgagactcggacctatatgcgtcaagtgctagaggggatatgctatctg
catcagagccatgtgctgcacctggatgtcaagccggagaacctgcttgtgtgggatggt
gcagggggtgaagagcaggtgcgcatctgtgacttcgggaacgcccaggaactcactccg
ggagagccccagtactgtcagtatggcacgccagagtttgtagcacctgagattgtcaac
cagagccctgtgtctggagtcactgacatctggcccgtgggcgtcgttgcctttctctgt
ttgacgggcatctccccatttgttggggagaatgaccggacaacactcatgaatatccga
aactacaacgtggcatttgaggagactacgttcctgagtctgagcagggaggcccggggc
ttcctcatcaaagtgctggtgcaggatcgactgagacctactgcagaagagacattggaa
catccttggttcaaaacagaagcaaagggtgcagaggtgagcacagatcacctgaagctc
ttcctgtcacggaggaggtggcagcgctctcaaatcagctacaagtgccacctggtgctg
cgccccattccggaactgctacgggctcccccggagcgggtgtgggtggccatgcctaga
agacaacccccgagtgggggactctcatcctcttcagactcagaagaggaagagttggag
gaacttccctcagtaccccgccccctgcagcctgagttctcaggttctcgggtatccctc
accgacatccccaccgaagatgaggctctggggaccccggaagctggggctgccaccccc
atggactggcaagagcaggaaaggactccctctaaggaccaggaggcccccagccctgag
gcactcccctctccaggccaggagtcccctgatgggcctagccccaggcggccagagctc
cgcaggggtagctctgctgagagtgccctgccccgagtcgggtcgcgggaaccgggccgg
agcttgcacaaggcagcatccgtggagctgccgcagcgcaggagccccagcccgggtgcc
acccgcctgactcggggaggcctgggtgagggcgagtatgcccagaggctgcaggccctg
cgtcagcggctgctgaggggaggccccgaggatggcaaggtcagcggcctcaggggaccc
ctgctggagagcctggggggccgtgcacgggatcccaggatggcaagggctgcctccagc
gaggctgccccccaccaccagccccctccggagtcccggggtctgcaaaagagcagcagc
ttctctcagggcgaggcagagccccggggtcggcaccgccgcgcgggggcacccctcgaa
atccccgtggccagacttggggctcgcaggctgcaggagtctccctccttatctgccctt
agcgagacccagccaccgagccctgcgaggcccagcgtccccaaactcagtatcaccaag
tccccggaaccttccgctgtcacatccagagactctccccagcccccggaacctcagcct
gtcccagaaaaggtccctgagcccaaaccagaaccagtccgagctgcaaaaccagcacaa
ccccctttggctctgcaaatgccaacgcagcctctcaccccctatgcccagatcatgcag
tcgctccagctgtccagtcccaccctgtccccacaggaccccgctgtgcctccatcagag
cccaagccccacgcggctgtgtttgccagggtggcttccccaccacccggagtctctgag
aagcgcgtgccttcggccagaactcccccagtgctagccgagaaagcccgagtccccacg
gtgccccccaggccaggcagcagcctcagcggcagcatcgaaaaccttgaatcagaggct
gtgttcgaggctaagttcaaacgcagccgcgaatcgccactgtcgcggggcctgaggcta
ctgagccgctcgcgctcggaggagcgcggtcccttccgtggggcggaggacgacggcata
taccggcccagtccggcaggaacgccgctagagctggtgcgacggcccgagcgctcgcgc
tccgtgcaggacctcagggtagccggagagccgggccttgtgcgtcgcctttcgctgtcc
ctgtcgcagaagctgcggcggacaccgccgggacagcgacaccctgcctgggagtcccgc
agcggagacggggagagctccgagggcggcagctcagctcgggcatccccagtgctggcg
gtacgcaggagactcagctccacgctggagcgtctgtccagccgtttgcagcgcagcggc
agcagcgaggactccgggggcgcctcgggtcgcagcacgccgctgtttggacggctgcgc
agggctacttcggaaggggagagcctgcgacgcctcggtgttccgcacaatcagctgggc
tctcagactggtgccactacaccttccgctgagtctctgggctcagaggccagtggcaca
tcgggttcttcagctcctggagaaagccgaagccggcaccggtggggcctttccaggctg
cgcaaggacaagggattatctcagccaaacctctcctccagtgtccaagaggacttgggt
caccagtatgtgcccagtgagtcagatttccccccagtcttccacatcaaactcaaggac
caggtgctgttggagggggaagcagccaccctgctctgcctacccgcagcctgcccagca
ccccgcatctcctggatgaaagataagcagtccctgcgttcagagccctcagtggtcatt
gtgtcctgcaaagatggacggcagctgctgagcataccccgggccggcaagcggcatgct
gggctctatgagtgctcagccaccaatgtcctgggcagcattaccagctcctgtactgtg
gccgtggcccgcattccagggaagctagctcctccagaggtgccccagacctaccatgac
acagcactagtagtgtggaagccaggagacggtcgggcaccttgcacatacactctggag
cggcgggtggatggggaatctgtctggcaccctgtgagctcaggcatccccgactgttat
tacaatgtgactcagctgcctgtcggcgtgaccgtgcggttccgtgtggcctgttccaat
cgtgctgggcaggggcccttcagcaacccttctgagaaggtcttcatccgaggcactcca
gattctcctgctcagccagctgctgctccccgagatgcccctgttacctcagggccaacc
agggccccaccgcctgactctcctacctcactggcccccacccccgctcttgcgccccca
gcctcccaggcatccactctcagcccctcaacttcctccatgtctgccaaccaggccttg
tcctcactcaaggctgtgggtccaccacccgcaacccctccacgaaagcacaggggcctt
ctggccacccagcaagcagagccatccccacccagtatcgtggtcaccccaagtgaaccc
aggtcttttgtccctgacactggaaccctgaccccaacctctagtcctcaaggggttaaa
ccagcaccttcctcaacttccttgtatatggtgacttccttcgtgtctgcacctccagcc
ccccaggccccagcccctgagccccctcctgagcccaccaaggtgactgtgcggagcctc
agcccagccaaggaggtggtcagctccccaactcctgagagcaccactcttcggcagggt
ccccctcagaaaccctacaccttcctggaggagaaggccaggggccgctttggcgttgtg
cggtcatgccgggagaatgctacgggccgaacgtttgtcgccaagatcgtgccgtacgcc
gcggagggcaagcgacgcgtgctgcaggaatacgaggtgcttcggacgctgcaccacgag
cggctcatgtccctgcacgaggcctacatcacccctcggtacctcgtgcttatcgctgag
agctgtggcaaccgggaactcctctgtgggctcagcgacagattccggtattcagaagat
gacgtggccacctatgtggtgcagctgctacaaggcctggactacctccacggccaccac
gtgctacacctggacatcaagccggacaatctactgttggccgctgacaatgcccttaaa
attgtggacttcggcagtgctcagccctataaccctcaggccctgaagccacttggccac
cgcacaggcactctggagttcatggctcctgagatggtgaagggagaccccattggctct
gccacggacatctggggagcgggtgtgctcacctacatcatgcttagtgggtactcccca
ttctatgagccagacccccaggaaacagaggctcggattgttgggggtcgctttgatgcc
ttccagttgtatcctaacacatcccagagtgccaccctcttcttgagaaaggtcctctca
gtacatccctggagccggccctctctgcaggactgcttggcccacccatggctgcaagat
gcctacctgatgaagctgcgccgccagacactcaccttcaccaccaaccggctcaaggaa
ttcctgggcgagcagcggcgacgtcgggctgaggctgctacccgtcacaaggtgctgctc
cgctcctaccctggcagcccctag

DBGET integrated database retrieval system