KEGG   Mus musculus (mouse): 11796Help
Entry
11796             CDS       T01002                                 

Gene name
Birc3, AW107670, Api1, Api2, Birc2, HIAP2, IAP1, IAP2, MIAP1, MIAP2, MIHB, MIHC, RNF49, cIAP-1, cIAP-2, cIAP1, cIAP2
Definition
(RefSeq) baculoviral IAP repeat-containing 3
  KO
K16060  
baculoviral IAP repeat-containing protein 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
Platinum drug resistance
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Apoptosis - multiple species
Focal adhesion
NOD-like receptor signaling pathway
TNF signaling pathway
Toxoplasmosis
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11796 (Birc3)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    11796 (Birc3)
   04668 TNF signaling pathway
    11796 (Birc3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    11796 (Birc3)
   04215 Apoptosis - multiple species
    11796 (Birc3)
  Cellular commiunity
   04510 Focal adhesion
    11796 (Birc3)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    11796 (Birc3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11796 (Birc3)
   05202 Transcriptional misregulation in cancers
    11796 (Birc3)
   05222 Small cell lung cancer
    11796 (Birc3)
  Infectious diseases
   05145 Toxoplasmosis
    11796 (Birc3)
  Antineoplastic resistance
   01524 Platinum drug resistance
    11796 (Birc3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    11796 (Birc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 A2
AA seq 602 aa AA seqDB search
MNMVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTGA
NDKVKCFCCGLMLDNWKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASPRPSLPSTAMST
MPLSFASSENTGYFSGSYSSFPSDPVNFRANQDCPALSTSPYHFAMNTEKARLLTYETWP
LSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQ
SASRYTVSNLSMQTHAARIRTFSNWPSSALVHSQELASAGFYYTGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLLRIKGQEFVSQVQAGYPHLLEQLLSTSDSPEDENADAA
IVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQWQILATGENYRTVSDLVIGLL
DAEDEMREEQMEQAAEEEESDDLALIRKNKMVLFQHLTCVTPMLYCLLSARAITEQECNA
VKQKPHTLQASTLIDTVLAKGNTAATSFRNSLREIDPALYRDIFVQQDIRSLPTDDIAAL
PMEEQLRKLQEERMCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTF
LS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggttcaagacagcgcctttctagccaagctgatgaagagtgctgacaccttt
gagttgaagtatgacttttcctgtgagctgtaccgattgtccacgtattcagcttttccc
aggggagttcctgtgtcagaaaggagtctggctcgtgctggcttttactacactggtgcc
aatgacaaggtcaagtgcttctgctgtggcctgatgctagacaactggaaacaaggggac
agtcccatggagaagcacagaaagttgtaccccagctgcaactttgtacagactttgaat
ccagccaacagtctggaagctagtcctcggccttctcttccttccacggcgatgagcacc
atgcctttgagctttgcaagttctgagaatactggctatttcagtggctcttactcgagc
tttccctcagaccctgtgaacttccgagcaaatcaagattgtcctgctttgagcacaagt
ccctaccactttgcaatgaacacagagaaggccagattactcacctatgaaacatggcca
ttgtcttttctgtcaccagcaaagctggccaaagcaggcttctactacataggacctgga
gatagagtggcctgctttgcgtgcgatgggaaactgagcaactgggaacgtaaggatgat
gctatgtcagagcaccagaggcatttccccagctgtccgttcttaaaagacttgggtcag
tctgcttcgagatacactgtctctaacctgagcatgcagacacacgcagcccgtattaga
acattctctaactggccttctagtgcactagttcattcccaggaacttgcaagtgcgggc
ttttattatacaggacacagtgatgatgtcaagtgtttttgctgtgatggtgggctgagg
tgctgggaatctggagatgacccctgggtggaacatgccaagtggtttccaaggtgtgag
tacttgctcagaatcaaaggccaagaatttgtcagccaagttcaagctggctatcctcat
ctacttgagcagctattatctacgtcagactccccagaagatgagaatgcagacgcagca
atcgtgcattttggccctggagaaagttcggaagatgtcgtcatgatgagcacgcctgtg
gttaaagcagccttggaaatgggcttcagtaggagcctggtgagacagacggttcagtgg
cagatcctggccactggtgagaactacaggaccgtcagtgacctcgttataggcttactc
gatgcagaagacgagatgagagaggagcagatggagcaggcggccgaggaggaggagtca
gatgatctagcactaatccggaagaacaaaatggtgcttttccaacatttgacgtgtgtg
acaccaatgctgtattgcctcctaagtgcaagggccatcactgaacaggagtgcaatgct
gtgaaacagaaaccacacaccttacaagcaagcacactgattgatactgtgttagcaaaa
ggaaacactgcagcaacctcattcagaaactcccttcgggaaattgaccctgcgttatac
agagatatatttgtgcaacaggacattaggagtcttcccacagatgacattgcagctcta
ccaatggaagaacagttgcggaaactccaggaggaaagaatgtgtaaagtgtgtatggac
cgagaggtatccatcgtgttcattccctgtggccatctggtcgtgtgcaaagactgcgct
ccctctctgaggaagtgtcccatctgtagagggaccatcaagggcacagtgcgcacattt
ctctcctga

DBGET integrated database retrieval system