KEGG   Mus musculus (mouse): 11798Help
Entry
11798             CDS       T01002                                 

Gene name
Xiap, 1110015C02Rik, Aipa, Api3, Birc4, IAP3, ILP-1, MIHA, mXIAP
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11798 (Xiap)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    11798 (Xiap)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    11798 (Xiap)
  Cell communication
   04510 Focal adhesion
    11798 (Xiap)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11798 (Xiap)
   05222 Small cell lung cancer
    11798 (Xiap)
  Infectious diseases
   05166 HTLV-I infection
    11798 (Xiap)
   05145 Toxoplasmosis
    11798 (Xiap)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    11798 (Xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X A3-A5
AA seq 496 aa AA seqDB search
MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQSTNPGIQNGQYKSENC
VGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPS
LTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDN
TEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKC
PMCYTVITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggaactagaacttttgtacttgcagacaccaataaggat
gaagaatttgtagaagagtttaatagattaaaaacatttgctaacttcccaagtagtagt
cctgtttcagcatcaacattggcgcgagctgggtttctttataccggtgaaggagacacc
gtgcaatgtttcagttgtcatgcggcaatagatagatggcagtatggagactcagctgtt
ggaagacacaggagaatatccccaaattgcagatttatcaatggtttttattttgaaaat
ggtgctgcacagtctacaaatcctggtatccaaaatggccagtacaaatctgaaaactgt
gtgggaaatagaaatccttttgcccctgacaggccacctgagactcatgctgattatctc
ttgagaactggacaggttgtagatatttcagacaccatatacccgaggaaccctgccatg
tgtagtgaagaagccagattgaagtcatttcagaactggccggactatgctcatttaacc
cccagagagttagctagtgctggcctctactacacaggggctgatgatcaagtgcaatgc
ttttgttgtgggggaaaactgaaaaattgggaaccctgtgatcgtgcctggtcagaacac
aggagacactttcccaattgcttttttgttttgggccggaacgttaatgttcgaagtgaa
tctggtgtgagttctgataggaatttcccaaattcaacaaactctccaagaaatccagcc
atggcagaatatgaagcacggatcgttacttttggaacatggacatcctcagttaacaag
gagcagcttgcaagagctggattttatgctttaggtgaaggcgataaagtgaagtgcttt
cactgtggaggagggctcacggattggaagccaagtgaagacccttgggaacagcatgcg
aagtggtacccagggtgcaaatacctattggatgagaaggggcaagaatatataaataat
attcatttaacccattcacttgaggaatctttgggaagaactgctgaaaaaacaccatcg
ctaactaaaaaaatcgatgataccatcttccagaatcctatggtgcaagaagctatacga
atgggatttagcttcaaggacattaagaaaacaatggaagaaaaaatccaaacatccggg
agcagctatctatcacttgaggtcctgattgcagatcttgtgagtgctcagaaagataat
acggaggatgagtcaagtcaaacttcattgcagaaagacattagtactgaagagcagcta
aggcgcctacaagaggagaagctttgcaaaatctgtatggatagaaatattgctatcgtt
tttgttccttgtggacatctggtcacttgtaaacagtgtgcagaagcagttgacaaatgt
cccatgtgctacaccgtcattacgttcaagcaaaaaatttttatgtcttag

DBGET integrated database retrieval system