KEGG   Mus musculus (mouse): 11798Help
Entry
11798             CDS       T01002                                 

Gene name
Xiap, 1110015C02Rik, Aipa, Api3, Birc4, IAP3, ILP-1, MIHA, mXIAP
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:mmu04120]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:mmu04064]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mmu04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:mmu04510]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:mmu05222]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mmu05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X A3-A5
AA seq 496 aa AA seqDB search
MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQSTNPGIQNGQYKSENC
VGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPS
LTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDN
TEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKC
PMCYTVITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggaactagaacttttgtacttgcagacaccaataaggat
gaagaatttgtagaagagtttaatagattaaaaacatttgctaacttcccaagtagtagt
cctgtttcagcatcaacattggcgcgagctgggtttctttataccggtgaaggagacacc
gtgcaatgtttcagttgtcatgcggcaatagatagatggcagtatggagactcagctgtt
ggaagacacaggagaatatccccaaattgcagatttatcaatggtttttattttgaaaat
ggtgctgcacagtctacaaatcctggtatccaaaatggccagtacaaatctgaaaactgt
gtgggaaatagaaatccttttgcccctgacaggccacctgagactcatgctgattatctc
ttgagaactggacaggttgtagatatttcagacaccatatacccgaggaaccctgccatg
tgtagtgaagaagccagattgaagtcatttcagaactggccggactatgctcatttaacc
cccagagagttagctagtgctggcctctactacacaggggctgatgatcaagtgcaatgc
ttttgttgtgggggaaaactgaaaaattgggaaccctgtgatcgtgcctggtcagaacac
aggagacactttcccaattgcttttttgttttgggccggaacgttaatgttcgaagtgaa
tctggtgtgagttctgataggaatttcccaaattcaacaaactctccaagaaatccagcc
atggcagaatatgaagcacggatcgttacttttggaacatggacatcctcagttaacaag
gagcagcttgcaagagctggattttatgctttaggtgaaggcgataaagtgaagtgcttt
cactgtggaggagggctcacggattggaagccaagtgaagacccttgggaacagcatgcg
aagtggtacccagggtgcaaatacctattggatgagaaggggcaagaatatataaataat
attcatttaacccattcacttgaggaatctttgggaagaactgctgaaaaaacaccatcg
ctaactaaaaaaatcgatgataccatcttccagaatcctatggtgcaagaagctatacga
atgggatttagcttcaaggacattaagaaaacaatggaagaaaaaatccaaacatccggg
agcagctatctatcacttgaggtcctgattgcagatcttgtgagtgctcagaaagataat
acggaggatgagtcaagtcaaacttcattgcagaaagacattagtactgaagagcagcta
aggcgcctacaagaggagaagctttgcaaaatctgtatggatagaaatattgctatcgtt
tttgttccttgtggacatctggtcacttgtaaacagtgtgcagaagcagttgacaaatgt
cccatgtgctacaccgtcattacgttcaagcaaaaaatttttatgtcttag

DBGET integrated database retrieval system