KEGG   Mus musculus (mouse): 11808Help
Entry
11808             CDS       T01002                                 

Gene name
Apoa4, Apoa-4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
mmu  Mus musculus (mouse)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    11808 (Apoa4)
   04977 Vitamin digestion and absorption
    11808 (Apoa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 A5.2; 9 25.36 cM
AA seq 395 aa AA seqDB search
MFLKAAVLTLALVAITGTRAEVTSDQVANVVWDYFTQLSNNAKEAVEQFQKTDVTQQLST
LFQDKLGDASTYADGVHNKLVPFVVQLSGHLAQETERVKEEIKKELEDLRDRMMPHANKV
TQTFGENMQKLQEHLKPYAVDLQDQINTQTQEMKLQLTPYIQRMQTTIKENVDNLHTSMM
PLATNLKDKFNRNMEELKGHLTPRANELKATIDQNLEDLRRSLAPLTVGVQEKLNHQMEG
LAFQMKKNAEELQTKVSAKIDQLQKNLAPLVEDVQSKVKGNTEGLQKSLEDLNRQLEQQV
EEFRRTVEPMGEMFNKALVQQLEQFRQQLGPNSGEVESHLSFLEKSLREKVNSFMSTLEK
KGSPDQPQALPLPEQAQEQAQEQAQEQVQPKPLES
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgcggtgctgaccctggccctggtggccatcaccggcacccgggct
gaggtcacttcggaccaggtggccaatgtggtgtgggattactttacccagctaagcaac
aatgccaaggaggctgtagaacagtttcagaagacggatgtcactcagcagctcagtacc
ctcttccaggacaaacttggggatgctagtacgtatgctgatggggtgcacaacaagctg
gtgccctttgtcgtacagctgagtgggcatctagcccaggaaactgagagggtgaaggaa
gagatcaagaaggagctggaggacctacgtgaccgcatgatgccccatgccaacaaagta
acccagacgttcggggagaacatgcagaagttgcaggagcacctgaagccctatgccgtg
gacctgcaagatcagatcaacacacagacccaggaaatgaagctccagctgaccccatac
atccagcgcatgcagaccacgatcaaggagaatgtggacaacctgcacacctcgatgatg
ccccttgccaccaacttaaaggacaagtttaacaggaatatggaagagctcaaggggcac
ctaaccccccgtgccaacgagctgaaggccacgatcgaccagaacctggaggatctgcgc
cgcagcctggcccctctgacggtgggcgtgcaggagaaactcaaccatcagatggagggc
ctggccttccagatgaagaagaacgcggaggagctccagaccaaggtctccgcaaaaatc
gaccagctgcagaagaatctggccccgctggtggaagacgtgcagagcaaggtgaagggc
aacacggaagggctgcagaagtctctggaagacctgaacaggcagctggagcagcaggtg
gaggagttccgacgcactgtggagcccatgggagagatgttcaacaaggctctggtgcag
cagctggaacagttcagacagcagctgggtcccaattcgggggaggtggaaagccacttg
agcttcctggagaagagcctgagggagaaggtcaactcctttatgagcaccctggaaaaa
aaggggagcccagaccagcctcaagccctccccctcccggagcaggcccaggagcaggct
caggagcaggctcaggagcaggtgcagcccaaacctctggagagctga

DBGET integrated database retrieval system