KEGG   Mus musculus (mouse): 11808Help
Entry
11808             CDS       T01002                                 

Gene name
Apoa4, Apoa-4
Definition
(RefSeq) apolipoprotein A-IV
  KO
K08760  apolipoprotein A-IV
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04975  Fat digestion and absorption
mmu04977  Vitamin digestion and absorption
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    11808 (Apoa4)
   04979 Cholesterol metabolism
    11808 (Apoa4)
   04977 Vitamin digestion and absorption
    11808 (Apoa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein YtxH Baculo_PEP_C BshC ApoLp-III Gp58 DUF883 SF-assemblin DUF4455 Prominin Syntaxin-6_N Exonuc_VII_L DUF1664 DUF445 DUF5344 Collagen_mid AAA_32 Apo-CIII 7TMR-HDED PP2C_C CorA MAAL_C Imm49
Motif
Other DBs
NCBI-GeneID: 11808
NCBI-ProteinID: NP_031494
MGI: 88051
Ensembl: ENSMUSG00000032080
Vega: OTTMUSG00000028705
UniProt: P06728
Position
9 A5.2; 9 25.36 cM
AA seq 395 aa AA seqDB search
MFLKAAVLTLALVAITGTRAEVTSDQVANVVWDYFTQLSNNAKEAVEQFQKTDVTQQLST
LFQDKLGDASTYADGVHNKLVPFVVQLSGHLAQETERVKEEIKKELEDLRDRMMPHANKV
TQTFGENMQKLQEHLKPYAVDLQDQINTQTQEMKLQLTPYIQRMQTTIKENVDNLHTSMM
PLATNLKDKFNRNMEELKGHLTPRANELKATIDQNLEDLRRSLAPLTVGVQEKLNHQMEG
LAFQMKKNAEELQTKVSAKIDQLQKNLAPLVEDVQSKVKGNTEGLQKSLEDLNRQLEQQV
EEFRRTVEPMGEMFNKALVQQLEQFRQQLGPNSGEVESHLSFLEKSLREKVNSFMSTLEK
KGSPDQPQALPLPEQAQEQAQEQAQEQVQPKPLES
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgcggtgctgaccctggccctggtggccatcaccggcacccgggct
gaggtcacttcggaccaggtggccaatgtggtgtgggattactttacccagctaagcaac
aatgccaaggaggctgtagaacagtttcagaagacggatgtcactcagcagctcagtacc
ctcttccaggacaaacttggggatgctagtacgtatgctgatggggtgcacaacaagctg
gtgccctttgtcgtacagctgagtgggcatctagcccaggaaactgagagggtgaaggaa
gagatcaagaaggagctggaggacctacgtgaccgcatgatgccccatgccaacaaagta
acccagacgttcggggagaacatgcagaagttgcaggagcacctgaagccctatgccgtg
gacctgcaagatcagatcaacacacagacccaggaaatgaagctccagctgaccccatac
atccagcgcatgcagaccacgatcaaggagaatgtggacaacctgcacacctcgatgatg
ccccttgccaccaacttaaaggacaagtttaacaggaatatggaagagctcaaggggcac
ctaaccccccgtgccaacgagctgaaggccacgatcgaccagaacctggaggatctgcgc
cgcagcctggcccctctgacggtgggcgtgcaggagaaactcaaccatcagatggagggc
ctggccttccagatgaagaagaacgcggaggagctccagaccaaggtctccgcaaaaatc
gaccagctgcagaagaatctggccccgctggtggaagacgtgcagagcaaggtgaagggc
aacacggaagggctgcagaagtctctggaagacctgaacaggcagctggagcagcaggtg
gaggagttccgacgcactgtggagcccatgggagagatgttcaacaaggctctggtgcag
cagctggaacagttcagacagcagctgggtcccaattcgggggaggtggaaagccacttg
agcttcctggagaagagcctgagggagaaggtcaactcctttatgagcaccctggaaaaa
aaggggagcccagaccagcctcaagccctccccctcccggagcaggcccaggagcaggct
caggagcaggctcaggagcaggtgcagcccaaacctctggagagctga

DBGET integrated database retrieval system