KEGG   Mus musculus (mouse): 11815Help
Entry
11815             CDS       T01002                                 

Gene name
Apod
Definition
(RefSeq) apolipoprotein D
  KO
K03098  
apolipoprotein D and lipocalin family protein
Organism
mmu  Mus musculus (mouse)
Brite
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   11815 (Apod)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 B2; 16 21.41 cM
AA seq 189 aa AA seqDB search
MVTMLMFLATLAGLFTTAKGQNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGN
CIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWI
LATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTT
DQANCPDFL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccatgctgatgttcctggccacgctggcgggtctcttcaccacagccaaagga
caaaatttccatcttgggaaatgcccgtctcctcctgtgcaagagaattttgacgtgaaa
aagtatcttggaagatggtacgaaattgagaagatcccagcgagctttgagaaaggaaac
tgcattcaagccaactactcgctgatggagaacggaaacatcgaagtgctaaacaaggag
ctgagtcctgatggaaccatgaaccaagtaaagggtgaagccaaacagagcaacgtctca
gagccagccaagctggaagtccagttcttcccgttgatgccaccggcaccctactggatc
ctggccaccgattatgaaaactatgccctcgtgtactcctgcaccaccttcttctggctc
ttccatgtggattttgtttggattcttggaagaaatccttatctccctccagaaacaata
acctacctaaaagatatccttacttctaatggcatcgacatcgaaaaaatgacaacaaca
gatcaagcgaactgcccggacttcctgtaa

DBGET integrated database retrieval system