KEGG   Mus musculus (mouse): 11819Help
Entry
11819             CDS       T01002                                 

Gene name
Nr2f2, 2700033K02Rik, 9430015G03Rik, ARP-1, Aporp1, COUP-TF2, COUP-TFII, COUPTFB, EAR3, SVP40, Tcfcoup2
Definition
(RefSeq) nuclear receptor subfamily 2, group F, member 2
  KO
K08548  
COUP transcription factor 2
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    11819 (Nr2f2)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2F. COUP-TF like receptor
   11819 (Nr2f2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 D1; 7 38.66 cM
AA seq 414 aa AA seqDB search
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggtagtcagcacgtggcgcgacccccaggacgaggtgcccggctctcagggc
agccaggcctcgcaggcgccgcccgtgccgggcccgccgcctggcgccccgcacacgcca
cagacgccgggccaagggggcccggccagcacgccggcccagacagcggctggcggccag
ggcggccctggcggcccgggcagcgacaagcagcagcagcagcagcacatcgagtgcgtg
gtgtgcggggacaagtcgagcggcaagcactacggccagttcacgtgcgagggctgcaag
agcttcttcaagcgcagcgtgcggaggaacctgagctacacgtgccgcgccaaccggaac
tgtcccatcgaccagcaccaccgcaaccagtgccagtactgccgcctcaaaaagtgcctc
aaagtgggcatgagacgggaagctgtacagagaggcaggatgcctcctacccagcctacc
cacgggcagtttgccctgaccaacggggaccccctcaactgccactcgtacctgtccgga
tatatttccctgctgctgcgcgcggagccctaccccacgtcgcgcttcggcagtcagtgc
atgcagcctaacaacatcatgggcatcgagaacatttgcgaactggccgcacggatgctc
ttcagcgccgttgagtgggcccggaacatccccttcttccctgacctgcagatcacggac
caggtggccctccttcgcctcacctggagcgagctgttcgtgttgaatgcggcccagtgc
tccatgcccctccatgtcgccccgctccttgccgctgctggcctgcacgcttcacccatg
tcagccgaccgggtggtcgcttttatggaccacatacggatcttccaagagcaagtggag
aagctcaaggcactgcacgtcgactccgccgagtatagctgcctcaaggccatagtcctg
ttcacctcagatgcctgtggtctgtctgatgtagcccatgtggaaagcttgcaggaaaag
tcccagtgtgctttggaagagtacgttaggagccagtaccccaaccagccaacacggttc
ggaaagctcttgcttcgtctcccttccctccgcacggtctcctcctcagtcatagagcaa
ttgtttttcgtccgtttggtaggtaaaacccccatcgaaaccctcatccgggatatgtta
ctgtccggcagcagttttaactggccatatatggcaattcaataa

DBGET integrated database retrieval system