KEGG   Mus musculus (mouse): 11826Help
Entry
11826             CDS       T01002                                 

Gene name
Aqp1, CHIP28
Definition
(RefSeq) aquaporin 1 (EC:2.7.1.21)
  KO
K09864  
aquaporin-1
Organism
mmu  Mus musculus (mouse)
Pathway
Renin secretion
Proximal tubule bicarbonate reclamation
Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    11826 (Aqp1)
  Digestive system
   04976 Bile secretion
    11826 (Aqp1)
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    11826 (Aqp1)
Transporters [BR:mmu02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    11826 (Aqp1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11826 (Aqp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 B3; 6 27.38 cM
AA seq 269 aa AA seqDB search
MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLV
DNSLGRNDLAHGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDFTD
RMKVWTSGQVEEYDLDADDINSRVEMKPK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgaaatcaagaagaagctcttctggagggctgtggtggctgagttcctggcc
atgaccctcttcgtcttcatcagcattggttctgccctaggcttcaattacccactggag
agaaaccagacgctggtccaggacaacgtgaaggtgtcgctggcctttggtttgagcatc
gctactctggcccaaagtgtgggtcacatcagcggtgctcacctcaaccctgcggtcaca
ctggggctcctgctcagctgtcagatcagcatcctccgggctgtcatgtacatcatcgcc
cagtgtgtgggagccatcgtcgccacggccattctctcgggcatcacctcctccctagtc
gacaattcacttggccgcaatgacctggctcacggtgtgaactctggccagggcctgggc
attgagatcattggcactctgcagctggtactgtgcgttctggccaccactgaccggagg
cgccgagacttaggtggctcagccccgcttgccattggcttgtctgtggcccttggacac
ctgctggcgattgactacactggctgcggtatcaaccctgcccggtcatttggctctgct
gtgctcacccgcaacttctcaaaccactggattttctgggtggggccgttcattgggggt
gccctggcagtgctcatctatgacttcatcctggccccacgcagcagcgacttcacagac
cgcatgaaggtgtggaccagtggccaggtggaggagtatgacctggatgctgacgacatc
aactccagggtggagatgaagcccaaatag

DBGET integrated database retrieval system